Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RELA Antibody Titration: 1.0ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit RELA Polyclonal Antibody | anti-RELA antibody

RELA antibody - N-terminal region

Gene Names
RELA; p65; CMCU; NFKB3
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
RELA; Polyclonal Antibody; RELA antibody - N-terminal region; anti-RELA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG
Sequence Length
551
Applicable Applications for anti-RELA antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RELA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RELA Antibody Titration: 1.0ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-RELA Antibody Titration: 1.0ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RELA antibody
This is a rabbit polyclonal antibody against RELA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
transcription factor p65 isoform 1
NCBI Official Synonym Full Names
RELA proto-oncogene, NF-kB subunit
NCBI Official Symbol
RELA
NCBI Official Synonym Symbols
p65; CMCU; NFKB3
NCBI Protein Information
transcription factor p65
UniProt Protein Name
Transcription factor p65
Protein Family
UniProt Gene Name
RELA
UniProt Synonym Gene Names
NFKB3
UniProt Entry Name
TF65_HUMAN

NCBI Description

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

NFkB-p65: a subunit of NF-kappa-B transcription complex, which plays a crucial role in inflammatory and immune responses. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. P65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. Three splice-variant isoforms have been identified.

Protein type: Transcription factor; Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; cytosol; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; identical protein binding; NF-kappaB binding; protein binding; transcription activator binding; DNA binding; protein heterodimerization activity; ubiquitin protein ligase binding; protein complex binding; protein N-terminus binding; chromatin binding; phosphate binding; transcription factor activity; protein kinase binding; transcription factor binding

Biological Process: viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; negative regulation of insulin receptor signaling pathway; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 5 signaling pathway; hair follicle development; toll-like receptor 4 signaling pathway; defense response to virus; response to drug; membrane protein intracellular domain proteolysis; positive regulation of I-kappaB kinase/NF-kappaB cascade; acetaldehyde metabolic process; response to amino acid stimulus; toll-like receptor 2 signaling pathway; organ morphogenesis; positive regulation of chondrocyte differentiation; response to muramyl dipeptide; response to mechanical stimulus; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of transcription, DNA-dependent; response to progesterone stimulus; negative regulation of protein catabolic process; negative regulation of apoptosis; transcription from RNA polymerase II promoter; response to cAMP; response to morphine; negative regulation of transcription from RNA polymerase II promoter; toll-like receptor 10 signaling pathway; response to insulin stimulus; response to organic substance; positive regulation of cell proliferation; positive regulation of interferon type I production; inflammatory response; aging; positive regulation of Schwann cell differentiation; MyD88-independent toll-like receptor signaling pathway; cytokine and chemokine mediated signaling pathway; liver development; response to UV-B; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interleukin-12 biosynthetic process; regulation of inflammatory response; toll-like receptor signaling pathway; cellular defense response; innate immune response; response to cobalamin

Research Articles on RELA

Similar Products

Product Notes

The RELA rela (Catalog #AAA3224592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RELA antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RELA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RELA rela for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEIIEQPKQR GMRFRYKCEG RSAGSIPGER STDTTKTHPT IKINGYTGPG. It is sometimes possible for the material contained within the vial of "RELA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.