Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RNASELSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Rabbit RNASEL Polyclonal Antibody | anti-RNASEL antibody

RNASEL antibody - C-terminal region

Gene Names
RNASEL; RNS4; PRCA1
Reactivity
Cow, Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Protein A purified
Synonyms
RNASEL; Polyclonal Antibody; RNASEL antibody - C-terminal region; anti-RNASEL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA
Sequence Length
741
Applicable Applications for anti-RNASEL antibody
Western Blot (WB)
Homology
Cow: 78%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RNASELSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RNASELSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-RNASEL antibody
This is a rabbit polyclonal antibody against RNASEL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele.
Product Categories/Family for anti-RNASEL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
2-5A-dependent ribonuclease
NCBI Official Synonym Full Names
ribonuclease L
NCBI Official Symbol
RNASEL
NCBI Official Synonym Symbols
RNS4; PRCA1
NCBI Protein Information
2-5A-dependent ribonuclease
UniProt Protein Name
2-5A-dependent ribonuclease
UniProt Gene Name
RNASEL
UniProt Synonym Gene Names
RNS4; 2-5A-dependent RNase; RNase L

NCBI Description

This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele. [provided by RefSeq, Jul 2008]

Uniprot Description

Endoribonuclease that functions in the interferon (IFN) antiviral response. In INF treated and virus infected cells, RNASEL probably mediates its antiviral effects through a combination of direct cleavage of single-stranded viral RNAs, inhibition of protein synthesis through the degradation of rRNA, induction of apoptosis, and induction of other antiviral genes. RNASEL mediated apoptosis is the result of a JNK-dependent stress-response pathway leading to cytochrome c release from mitochondria and caspase-dependent apoptosis. Therefore, activation of RNASEL could lead to elimination of virus infected cells under some circumstances. In the crosstalk between autophagy and apoptosis proposed to induce autophagy as an early stress response to small double-stranded RNA and at later stages of prolonged stress to activate caspase-dependent proteolytic cleavage of BECN1 to terminate autophagy and promote apoptosis (PubMed:26263979). Might play a central role in the regulation of mRNA turnover (PubMed:11585831).

Research Articles on RNASEL

Similar Products

Product Notes

The RNASEL rnasel (Catalog #AAA3224446) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASEL antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's RNASEL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNASEL rnasel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKLKIGDPSL YFQKTFPDLV IYVYTKLQNT EYRKHFPQTH SPNKPQCDGA. It is sometimes possible for the material contained within the vial of "RNASEL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.