Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNFSF14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTNFSF14 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Dog TNFSF14 Polyclonal Antibody | anti-TNFSF14 antibody

TNFSF14 antibody - middle region

Gene Names
TNFSF14; LTg; CD258; HVEML; LIGHT
Reactivity
Dog
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFSF14; Polyclonal Antibody; TNFSF14 antibody - middle region; anti-TNFSF14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM
Sequence Length
240
Applicable Applications for anti-TNFSF14 antibody
Western Blot (WB)
Homology
Dog: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TNFSF14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNFSF14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTNFSF14 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-TNFSF14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTNFSF14 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-TNFSF14 antibody
This is a rabbit polyclonal antibody against TNFSF14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TNFSF14 is the cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B TNFSF14 modulates its effects. TNFSF14 activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. TNFSF14 acts as a receptor for Herpes simplex virus.The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 14 isoform 1
NCBI Official Synonym Full Names
TNF superfamily member 14
NCBI Official Symbol
TNFSF14
NCBI Official Synonym Symbols
LTg; CD258; HVEML; LIGHT
NCBI Protein Information
tumor necrosis factor ligand superfamily member 14
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 14
UniProt Gene Name
TNFSF14
UniProt Synonym Gene Names
HVEML; LIGHT; HVEM-L
UniProt Entry Name
TNF14_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF14: Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. Acts as a receptor for Herpes simplex virus. Belongs to the tumor necrosis factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cytokine; Inhibitor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; cytoplasm; plasma membrane; integral to membrane

Molecular Function: protein binding; caspase inhibitor activity; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: release of cytoplasmic sequestered NF-kappaB; T cell proliferation; T cell activation; apoptosis; T cell costimulation; T cell homeostasis; immune response; negative regulation of caspase activity; signal transduction; positive regulation of myoblast differentiation

Research Articles on TNFSF14

Similar Products

Product Notes

The TNFSF14 tnfsf14 (Catalog #AAA3224352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFSF14 antibody - middle region reacts with Dog and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFSF14 tnfsf14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATSSSRVWWD SSFLGGVVHL EAGEKVVVRV LDERLVRLRD GTRSYFGAFM. It is sometimes possible for the material contained within the vial of "TNFSF14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.