Western Blot (WB)
(Host: RabbitTarget Name: IGH-VJ558Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse IGH-VJ558 Polyclonal Antibody | anti-IGH-VJ558 antibody
IGH-VJ558 Antibody - middle region
Gene Names
Igh-VJ558; AI893585
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
IGH-VJ558; Polyclonal Antibody; IGH-VJ558 Antibody - middle region; anti-IGH-VJ558 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKP
Sequence Length
117
Applicable Applications for anti-IGH-VJ558 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse IGH-VJ558
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: IGH-VJ558Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: IGH-VJ558Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IGH-VJ558 antibody
This germline gene belongs to a set of closely related genes that could encode V regions of NPb antibodies.
Product Categories/Family for anti-IGH-VJ558 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
13 kDa
NCBI Official Full Name
Ig heavy chain V region 1-62-3
NCBI Official Synonym Full Names
immunoglobulin heavy chain (J558 family)
NCBI Official Symbol
Igh-VJ558
NCBI Official Synonym Symbols
AI893585
UniProt Protein Name
Ig heavy chain V region 1-62-3
Protein Family
UniProt Gene Name
Ighv1-62-3
UniProt Synonym Gene Names
Igh-VJ558
Uniprot Description
MiscellaneousThis germline gene belongs to a set of closely related genes that could encode V regions of NPb antibodies.
Research Articles on IGH-VJ558
Similar Products
Product Notes
The IGH-VJ558 ighv1-62-3 (Catalog #AAA3223864) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGH-VJ558 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IGH-VJ558 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IGH-VJ558 ighv1-62-3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYTFTSYWMH WVKQRPGRGL EWIGRIDPNS GGTKYNEKFK SKATLTVDKP. It is sometimes possible for the material contained within the vial of "IGH-VJ558, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
