Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FCGR1ASample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FCGR1A Polyclonal Antibody | anti-FCGR1A antibody

FCGR1A Antibody - middle region

Gene Names
FCGR1A; CD64; FCRI; CD64A; IGFR1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FCGR1A; Polyclonal Antibody; FCGR1A Antibody - middle region; anti-FCGR1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVLKRSPELELQVLGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL
Sequence Length
374
Applicable Applications for anti-FCGR1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FCGR1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FCGR1ASample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FCGR1ASample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FCGR1A antibody
This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1.
Product Categories/Family for anti-FCGR1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
high affinity immunoglobulin gamma Fc receptor I
NCBI Official Synonym Full Names
Fc fragment of IgG receptor Ia
NCBI Official Symbol
FCGR1A
NCBI Official Synonym Symbols
CD64; FCRI; CD64A; IGFR1
NCBI Protein Information
high affinity immunoglobulin gamma Fc receptor I
UniProt Protein Name
High affinity immunoglobulin gamma Fc receptor I
UniProt Gene Name
FCGR1A
UniProt Synonym Gene Names
FCG1; FCGR1; IGFR1; IgG Fc receptor I; FcRI; FcgammaRIa
UniProt Entry Name
FCGR1_HUMAN

NCBI Description

This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

FCGR1A: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses. Belongs to the immunoglobulin superfamily. FCGR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.2-q21.3

Cellular Component: early endosome membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; IgG binding; receptor signaling protein activity

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; signal transduction; phagocytosis, engulfment

Research Articles on FCGR1A

Similar Products

Product Notes

The FCGR1A fcgr1a (Catalog #AAA3221664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCGR1A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCGR1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCGR1A fcgr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVLKRSPELE LQVLGLQLPT PVWFHVLFYL AVGIMFLVNT VLWVTIRKEL. It is sometimes possible for the material contained within the vial of "FCGR1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.