Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ACADMSample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ACADM Polyclonal Antibody | anti-ACADM antibody

ACADM Antibody - middle region

Gene Names
Acadm; MCAD; AU018656
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ACADM; Polyclonal Antibody; ACADM Antibody - middle region; anti-ACADM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDACLITEELAYGCTGVQTAIEANSLGQMPVILAGNDQQKKKYLGRMTEQ
Sequence Length
421
Applicable Applications for anti-ACADM antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ACADM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ACADMSample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACADMSample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ACADM antibody
This gene encodes a homotetrameric mitochondrial flavoprotein and is a member of the acyl-CoA dehydrogenase family. Members of this family catalyze the first step of fatty acid beta-oxidation, forming a C2-C3 trans-double bond in a FAD-dependent reaction. As beta-oxidation cycles through its four steps, each member of the acyl-CoA dehydrogenase family works at an optimum fatty acid chain-length. This enzyme has its optimum length between C6- and C12-acylCoA. In mice, deficiency of this gene can cause neonatal mortality as well as fasting and cold intolerance. This gene has multiple, intronless pseudogenes.
Product Categories/Family for anti-ACADM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
medium-chain specific acyl-CoA dehydrogenase, mitochondrial
NCBI Official Synonym Full Names
acyl-Coenzyme A dehydrogenase, medium chain
NCBI Official Symbol
Acadm
NCBI Official Synonym Symbols
MCAD; AU018656
NCBI Protein Information
medium-chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Protein Name
Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Gene Name
Acadm
UniProt Synonym Gene Names
MCAD
UniProt Entry Name
ACADM_MOUSE

NCBI Description

This gene encodes a homotetrameric mitochondrial flavoprotein and is a member of the acyl-CoA dehydrogenase family. Members of this family catalyze the first step of fatty acid beta-oxidation, forming a C2-C3 trans-double bond in a FAD-dependent reaction. As beta-oxidation cycles through its four steps, each member of the acyl-CoA dehydrogenase family works at an optimum fatty acid chain-length. This enzyme has its optimum length between C6- and C12-acylCoA. In mice, deficiency of this gene can cause neonatal mortality as well as fasting and cold intolerance. This gene has multiple, intronless pseudogenes. [provided by RefSeq, Nov 2012]

Research Articles on ACADM

Similar Products

Product Notes

The ACADM acadm (Catalog #AAA3223699) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACADM Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ACADM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACADM acadm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDACLITEEL AYGCTGVQTA IEANSLGQMP VILAGNDQQK KKYLGRMTEQ. It is sometimes possible for the material contained within the vial of "ACADM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.