Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RANBP9Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RANBP9 Polyclonal Antibody | anti-RANBP9 antibody

RANBP9 Antibody - middle region

Gene Names
RANBP9; BPM-L; BPM90; RANBPM; RanBP7
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RANBP9; Polyclonal Antibody; RANBP9 Antibody - middle region; anti-RANBP9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPT
Sequence Length
533
Applicable Applications for anti-RANBP9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RANBP9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RANBP9Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RANBP9Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RANBP9 antibody
This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.
Product Categories/Family for anti-RANBP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
ran-binding protein 9
NCBI Official Synonym Full Names
RAN binding protein 9
NCBI Official Symbol
RANBP9
NCBI Official Synonym Symbols
BPM-L; BPM90; RANBPM; RanBP7
NCBI Protein Information
ran-binding protein 9
UniProt Protein Name
Ran-binding protein 10
Protein Family
UniProt Gene Name
RANBP10
UniProt Synonym Gene Names
KIAA1464; RanBP10
UniProt Entry Name
RBP10_HUMAN

NCBI Description

This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11. [provided by RefSeq, Jul 2008]

Uniprot Description

RANBP10: Acts as a guanine nucleotide exchange factor (GEF) for RAN GTPase. May play an essential role in hemostasis and in maintaining microtubule dynamics with respect to both platelet shape and function. May act as an adapter protein to couple membrane receptors to intracellular signaling pathways. Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but does not affect estrogen- induced transactivation. In contrast to RANBP9, does not interact with Sos and does not activate the Ras pathway. Belongs to the RANBP9/10 family.

Protein type: GEFs; GEFs, Ras; GAPs; GAPs, Ras

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: cytoplasmic microtubule; cytosol; nucleus

Molecular Function: Ran guanyl-nucleotide exchange factor activity; beta-tubulin binding; Ran GTPase binding

Biological Process: microtubule cytoskeleton organization and biogenesis

Research Articles on RANBP9

Similar Products

Product Notes

The RANBP9 ranbp10 (Catalog #AAA3222570) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RANBP9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RANBP9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RANBP9 ranbp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRDGYMGIGL SAQGVNMNRL PGWDKHSYGY HGDDGHSFCS SGTGQPYGPT. It is sometimes possible for the material contained within the vial of "RANBP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.