Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BET1Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BET1 Polyclonal Antibody | anti-BET1 antibody

BET1 Antibody - N-terminal region

Gene Names
BET1; HBET1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BET1; Polyclonal Antibody; BET1 Antibody - N-terminal region; anti-BET1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQ
Sequence Length
118
Applicable Applications for anti-BET1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BET1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BET1Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BET1Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BET1 antibody
This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-BET1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12 kDa
NCBI Official Full Name
BET1 homolog isoform 1
NCBI Official Synonym Full Names
Bet1 golgi vesicular membrane trafficking protein
NCBI Official Symbol
BET1
NCBI Official Synonym Symbols
HBET1
NCBI Protein Information
BET1 homolog
UniProt Protein Name
BET1 homolog
Protein Family
UniProt Gene Name
BET1
UniProt Synonym Gene Names
hBET1
UniProt Entry Name
BET1_HUMAN

NCBI Description

This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

BET1: Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane. Belongs to the BET1 family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q21.1-q22

Cellular Component: Golgi membrane; Golgi cisterna; endoplasmic reticulum membrane; cis-Golgi network; membrane; integral to membrane

Molecular Function: protein binding; syntaxin binding

Biological Process: protein transport; ER to Golgi vesicle-mediated transport; vesicle fusion with Golgi apparatus

Research Articles on BET1

Similar Products

Product Notes

The BET1 bet1 (Catalog #AAA3221980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BET1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BET1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BET1 bet1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPGNYGNYGY ANSGYSACEE ENERLTESLR SKVTAIKSLS IEIGHEVKTQ. It is sometimes possible for the material contained within the vial of "BET1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.