Mouse anti-Human LATS1 Monoclonal Antibody | anti-LATS1 antibody

LATS1 (WARTS, Serine/Threonine-protein Kinase LATS1, Large Tumor Suppressor Homolog 1, WARTS Protein Kinase) (HRP)

Cat. Num. AAA6153281

• Gene Names: LATS1; wts; WARTS
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LATS1; Monoclonal Antibody; LATS1 (WARTS; Serine/Threonine-protein Kinase LATS1; Large Tumor Suppressor Homolog 1; WARTS Protein Kinase) (HRP); anti-LATS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A7
• Specificity: Recognizes human LATS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 7362

• Applicable Applications for anti-LATS1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa521-620 from LATS1 (NP_004681) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(LATS1 monoclonal antibody Western Blot analysis of LATS1 expression in HeLa)

Testing Data

(Detection limit for recombinant GST tagged LATS1 is ~10ng/ml as a capture antibody.)

Related Product Information for anti-LATS1 antibody

The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments.

Product Categories/Family for anti-LATS1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 1519246067
• NCBI GeneID: 9113
• NCBI Accession #: NM_004690.4
• NCBI GenBank Nucleotide #: NM_004690
• UniProt Accession #: O95835
• NCBI Official Full Name: Homo sapiens large tumor suppressor kinase 1 (LATS1), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: large tumor suppressor kinase 1
• NCBI Official Symbol: LATS1
• NCBI Official Synonym Symbols: wts; WARTS
• NCBI Protein Information: serine/threonine-protein kinase LATS1
• UniProt Protein Name: Serine/threonine-protein kinase LATS1
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: LATS1
• UniProt Synonym Gene Names: h-warts

NCBI Description

The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments. [provided by RefSeq, Apr 2017]

Uniprot Description

LATS1: an AGC kinase of the NDR family of kinases. Localized to the mitotic apparatus and specifically phosphorylated during mitosis. A likely tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDC2 kinase activity, causing G2 arrest. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. Complexes with CDC2 in early mitosis. LATS1-associated CDC2 has no mitotic cyclin partner and no apparent kinase activity. Binds phosphorylated zyxin, locating this protein to the mitotic spindle and suggesting a role for actin regulatory proteins during mitosis. Binds to and colocalizes with LIMK1 at the actomyosin contractile ring during cytokinesis. Knockout mice are susceptible to soft-tissue sarcomas and sensitive to chemical carcinogenesis. Human soft tissue sarcomas have downregulated, mutated, and/or hypermethylated LATS1. Transgenic expression blocks anchorage independent growth in culture and tumor growth in xenografts. Two alternatively spliced isoforms of the human proteinhave been described.

Protein type: AGC group; EC 2.7.11.1; Kinase, protein; NDR family; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Tumor suppressor

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: cytosol; spindle pole

Molecular Function: ATP binding; estrogen receptor binding; magnesium ion binding; protein binding; protein kinase binding; protein serine/threonine kinase activity

Biological Process: cytoplasmic sequestering of protein; G1/S transition of mitotic cell cycle; G2/M transition of mitotic cell cycle; hormone-mediated signaling; negative regulation of cyclin-dependent protein kinase activity; positive regulation of apoptosis; positive regulation of peptidyl-serine phosphorylation; protein amino acid phosphorylation; regulation of actin filament polymerization; regulation of estrogen receptor signaling pathway; regulation of organ growth; regulation of protein complex assembly; sister chromatid segregation