Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMED9Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TMED9 Polyclonal Antibody | anti-TMED9 antibody

TMED9 Antibody - middle region

Gene Names
TMED9; p25; GMP25; p24a2; HSGP25L2G; p24alpha2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMED9; Polyclonal Antibody; TMED9 Antibody - middle region; anti-TMED9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPED
Sequence Length
235
Applicable Applications for anti-TMED9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human TMED9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMED9Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMED9Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TMED9 antibody
Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB.
Product Categories/Family for anti-TMED9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
transmembrane emp24 domain-containing protein 9
NCBI Official Synonym Full Names
transmembrane p24 trafficking protein 9
NCBI Official Symbol
TMED9
NCBI Official Synonym Symbols
p25; GMP25; p24a2; HSGP25L2G; p24alpha2
NCBI Protein Information
transmembrane emp24 domain-containing protein 9
UniProt Protein Name
Transmembrane emp24 domain-containing protein 9
UniProt Gene Name
TMED9
UniProt Synonym Gene Names
GP25L2; p24alpha2
UniProt Entry Name
TMED9_HUMAN

NCBI Description

This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016]

Uniprot Description

TMED9: Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer- dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB. Belongs to the EMP24/GP25L family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; ER-Golgi intermediate compartment; ER-Golgi intermediate compartment membrane; Golgi apparatus; Golgi membrane; integral to membrane; trans-Golgi network transport vesicle; transport vesicle

Molecular Function: protein binding; syntaxin binding

Biological Process: cellular protein metabolic process; COPI coating of Golgi vesicle; ER to Golgi vesicle-mediated transport; Golgi organization and biogenesis; post-translational protein modification; protein amino acid N-linked glycosylation via asparagine; protein exit from endoplasmic reticulum

Similar Products

Product Notes

The TMED9 tmed9 (Catalog #AAA3222970) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMED9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMED9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMED9 tmed9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEKKCFIEEI PDETMVIGNY RTQLYDKQRE EYQPATPGLG MFVEVKDPED. It is sometimes possible for the material contained within the vial of "TMED9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.