Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAP2K4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAP2K4 Polyclonal Antibody | anti-MAP2K4 antibody

MAP2K4 Antibody - N-terminal region

Gene Names
MAP2K4; JNKK; MEK4; MKK4; SEK1; SKK1; JNKK1; SERK1; MAPKK4; PRKMK4; SAPKK1; SAPKK-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAP2K4; Polyclonal Antibody; MAP2K4 Antibody - N-terminal region; anti-MAP2K4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANP
Sequence Length
399
Applicable Applications for anti-MAP2K4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAP2K4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAP2K4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAP2K4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAP2K4 antibody
This gene encodes a member of the mitogen-activated protein kinase (MAPK) family. Members of this family act as an integration point for multiple biochemical signals and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. They form a three-tiered signaling module composed of MAPKKKs, MAPKKs, and MAPKs. This protein is phosphorylated at serine and threonine residues by MAPKKKs and subsequently phosphorylates downstream MAPK targets at threonine and tyrosine residues. A similar protein in mouse has been reported to play a role in liver organogenesis. A pseudogene of this gene is located on the long arm of chromosome X. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 4 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 4
NCBI Official Symbol
MAP2K4
NCBI Official Synonym Symbols
JNKK; MEK4; MKK4; SEK1; SKK1; JNKK1; SERK1; MAPKK4; PRKMK4; SAPKK1; SAPKK-1
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 4
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 4
UniProt Gene Name
MAP2K4
UniProt Synonym Gene Names
JNKK1; MEK4; MKK4; PRKMK4; SEK1; SERK1; SKK1; MAP kinase kinase 4; MAPKK 4; MEK 4; SEK1; SAPK kinase 1; SAPKK-1; SAPKK1; JNKK
UniProt Entry Name
MP2K4_HUMAN

NCBI Description

This gene encodes a member of the mitogen-activated protein kinase (MAPK) family. Members of this family act as an integration point for multiple biochemical signals and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. They form a three-tiered signaling module composed of MAPKKKs, MAPKKs, and MAPKs. This protein is phosphorylated at serine and threonine residues by MAPKKKs and subsequently phosphorylates downstream MAPK targets at threonine and tyrosine residues. A similar protein in mouse has been reported to play a role in liver organogenesis. A pseudogene of this gene is located on the long arm of chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

MKK4: dual specificity kinase of the STE7 family that phosphorylates and activates JNK1 and -2 as well as p38 but not ERK1 or -2. Mediates cellular responses to various cellular stresses and inflammatory cytokines. Phosphorylation by Akt inhibits MKK4 and suppresses stress-activated signal transduction.

Protein type: Kinase, protein; EC 2.7.12.2; Protein kinase, STE; Protein kinase, dual-specificity (non-receptor); STE group; STE7 family

Chromosomal Location of Human Ortholog: 17p12

Cellular Component: dendrite cytoplasm; axon; perikaryon; intracellular; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; protein-tyrosine kinase activity; mitogen-activated protein kinase kinase kinase binding; JUN kinase kinase activity; ATP binding; protein kinase activity

Biological Process: peptidyl-tyrosine phosphorylation; apoptosis; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; pathogenesis; toll-like receptor 3 signaling pathway; signal transduction; activation of JNK activity; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; positive regulation of neuron apoptosis; toll-like receptor signaling pathway; innate immune response; JNK cascade; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway; positive regulation of DNA replication; positive regulation of nitric-oxide synthase biosynthetic process

Research Articles on MAP2K4

Similar Products

Product Notes

The MAP2K4 map2k4 (Catalog #AAA3221607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP2K4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2K4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAP2K4 map2k4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAPSPSGGGG SGGGSGSGTP GPVGSPAPGH PAVSSMQGKR KALKLNFANP. It is sometimes possible for the material contained within the vial of "MAP2K4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.