Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: COQ9Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human COQ9 Polyclonal Antibody | anti-COQ9 antibody

COQ9 Antibody - middle region

Gene Names
COQ9; COQ10D5; C16orf49
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
COQ9; Polyclonal Antibody; COQ9 Antibody - middle region; anti-COQ9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWT
Sequence Length
318
Applicable Applications for anti-COQ9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human COQ9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: COQ9Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: COQ9Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-COQ9 antibody
This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.
Product Categories/Family for anti-COQ9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
ubiquinone biosynthesis protein COQ9, mitochondrial
NCBI Official Synonym Full Names
coenzyme Q9
NCBI Official Symbol
COQ9
NCBI Official Synonym Symbols
COQ10D5; C16orf49
NCBI Protein Information
ubiquinone biosynthesis protein COQ9, mitochondrial
UniProt Protein Name
Ubiquinone biosynthesis protein COQ9, mitochondrial
UniProt Gene Name
COQ9
UniProt Synonym Gene Names
C16orf49
UniProt Entry Name
COQ9_HUMAN

NCBI Description

This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010]

Uniprot Description

COQ9: Involved in the biosynthesis of coenzyme Q. Defects in COQ9 are the cause of coenzyme Q10 deficiency, primary, type 5 (COQ10D5). A form of coenzyme Q10 deficiency, an autosomal recessive disorder with variable manifestations consistent with 5 major phenotypes. The phenotypes include an encephalomyopathic form with seizures and ataxia; a multisystem infantile form with encephalopathy, cardiomyopathy and renal failure; a predominantly cerebellar form with ataxia and cerebellar atrophy; Leigh syndrome with growth retardation; and an isolated myopathic form. Belongs to the COQ9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: mitochondrial inner membrane; mitochondrion

Molecular Function: lipid binding; protein binding; protein homodimerization activity

Biological Process: ubiquinone biosynthetic process

Disease: Coenzyme Q10 Deficiency, Primary, 5

Research Articles on COQ9

Similar Products

Product Notes

The COQ9 coq9 (Catalog #AAA3221577) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COQ9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COQ9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COQ9 coq9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEKPDPESSH SPPRYTDQGG EEEEDYESEE QLQHRILTAA LEFVPAHGWT. It is sometimes possible for the material contained within the vial of "COQ9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.