Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAPK8IP1Sample Tissue: Human Nerve Fiber Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAPK8IP1 Polyclonal Antibody | anti-MAPK8IP1 antibody

MAPK8IP1 Antibody - middle region

Gene Names
MAPK8IP1; IB1; JIP1; JIP-1; PRKM8IP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPK8IP1; Polyclonal Antibody; MAPK8IP1 Antibody - middle region; anti-MAPK8IP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPP
Sequence Length
711
Applicable Applications for anti-MAPK8IP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAPK8IP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAPK8IP1Sample Tissue: Human Nerve Fiber Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAPK8IP1Sample Tissue: Human Nerve Fiber Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAPK8IP1 antibody
This gene encodes a regulator of the pancreatic beta-cell function. It is highly similar to JIP-1, a mouse protein known to be a regulator of c-Jun amino-terminal kinase (Mapk8). This protein has been shown to prevent MAPK8 mediated activation of transcription factors, and to decrease IL-1 beta and MAP kinase kinase 1 (MEKK1) induced apoptosis in pancreatic beta cells. This protein also functions as a DNA-binding transactivator of the glucose transporter GLUT2. RE1-silencing transcription factor (REST) is reported to repress the expression of this gene in insulin-secreting beta cells. This gene is found to be mutated in a type 2 diabetes family, and thus is thought to be a susceptibility gene for type 2 diabetes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78 kDa
NCBI Official Full Name
C-Jun-amino-terminal kinase-interacting protein 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 8 interacting protein 1
NCBI Official Symbol
MAPK8IP1
NCBI Official Synonym Symbols
IB1; JIP1; JIP-1; PRKM8IP
NCBI Protein Information
C-Jun-amino-terminal kinase-interacting protein 1
UniProt Protein Name
C-Jun-amino-terminal kinase-interacting protein 1
UniProt Gene Name
MAPK8IP1
UniProt Synonym Gene Names
IB1; JIP1; PRKM8IP; JIP-1; JNK-interacting protein 1; IB-1
UniProt Entry Name
JIP1_HUMAN

NCBI Description

This gene encodes a regulator of the pancreatic beta-cell function. It is highly similar to JIP-1, a mouse protein known to be a regulator of c-Jun amino-terminal kinase (Mapk8). This protein has been shown to prevent MAPK8 mediated activation of transcription factors, and to decrease IL-1 beta and MAP kinase kinase 1 (MEKK1) induced apoptosis in pancreatic beta cells. This protein also functions as a DNA-binding transactivator of the glucose transporter GLUT2. RE1-silencing transcription factor (REST) is reported to repress the expression of this gene in insulin-secreting beta cells. This gene is found to be mutated in a type 2 diabetes family, and thus is thought to be a susceptibility gene for type 2 diabetes. [provided by RefSeq, May 2011]

Research Articles on MAPK8IP1

Similar Products

Product Notes

The MAPK8IP1 mapk8ip1 (Catalog #AAA3221311) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK8IP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK8IP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK8IP1 mapk8ip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPRSQDTLNN NSLGKKHSWQ DRVSRSSSPL KTGEQTPPHE HICLSDELPP. It is sometimes possible for the material contained within the vial of "MAPK8IP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.