Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NAT1Sample Tissue: Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NAT1 Polyclonal Antibody | anti-NAT1 antibody

NAT1 Antibody - N-terminal region

Gene Names
NAT1; AAC1; MNAT; NATI; NAT-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NAT1; Polyclonal Antibody; NAT1 Antibody - N-terminal region; anti-NAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDL
Sequence Length
290
Applicable Applications for anti-NAT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N region of human NAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NAT1Sample Tissue: Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NAT1Sample Tissue: Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NAT1 antibody
This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
9
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
arylamine N-acetyltransferase 1 isoform a
NCBI Official Synonym Full Names
N-acetyltransferase 1
NCBI Official Symbol
NAT1
NCBI Official Synonym Symbols
AAC1; MNAT; NATI; NAT-1
NCBI Protein Information
arylamine N-acetyltransferase 1
UniProt Protein Name
Arylamine N-acetyltransferase 1
UniProt Gene Name
NAT1
UniProt Synonym Gene Names
AAC1; MNAT; NAT-1
UniProt Entry Name
ARY1_HUMAN

NCBI Description

This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

NAT1: Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens. Belongs to the arylamine N-acetyltransferase family.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; Acetyltransferase; Secondary Metabolites Metabolism - caffeine; EC 2.3.1.5

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: cytosol

Molecular Function: arylamine N-acetyltransferase activity

Biological Process: xenobiotic metabolic process

Research Articles on NAT1

Similar Products

Product Notes

The NAT1 nat1 (Catalog #AAA3220762) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAT1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAT1 nat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDIEAYLERI GYKKSRNKLD LETLTDILQH QIRAVPFENL NIHCGDAMDL. It is sometimes possible for the material contained within the vial of "NAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.