Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C5AR1Sample Tissue: COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human OPRPN Polyclonal Antibody | anti-OPRPN antibody

OPRPN Antibody - N-terminal region

Gene Names
C5AR1; C5A; C5AR; C5R1; CD88
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
OPRPN; Polyclonal Antibody; OPRPN Antibody - N-terminal region; anti-OPRPN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: SFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGV
Sequence Length
350
Applicable Applications for anti-OPRPN antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C5AR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C5AR1Sample Tissue: COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C5AR1Sample Tissue: COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OPRPN antibody
This gene encodes a member of the proline-rich protein family. The encoded protein has multiple proposed functions, including roles in pain suppression, penile erection, and protection of the eye surface. The QRFSR pentapeptide, known as opiorphin, is derived from the N-terminal of this protein. Opiorphin inhibits the enkephalin-inactivating peptidases neprilysin and aminopeptidase N, and this activity is thought to reduce sensitivity to painful stimuli by effecting enkephalin-related activation of opioid-dependent pathways. Opiorphin may also act as an anti-depressant. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-OPRPN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
728
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
C5a anaphylatoxin chemotactic receptor 1
NCBI Official Synonym Full Names
complement C5a receptor 1
NCBI Official Symbol
C5AR1
NCBI Official Synonym Symbols
C5A; C5AR; C5R1; CD88
NCBI Protein Information
C5a anaphylatoxin chemotactic receptor 1
UniProt Protein Name
C5a anaphylatoxin chemotactic receptor
Protein Family
UniProt Gene Name
C5AR1
UniProt Synonym Gene Names
C5AR; C5R1; C5a-R; C5aR
UniProt Entry Name
C5AR_HUMAN

Uniprot Description

C5aR: a family 1 G-protein coupled receptor that stimulates the GTPase activity of Gi2. Receptor for the chemotactic and inflammatory complement factor C5a. Stimulates chemotaxis, granule enzyme release and superoxide anion production. Phosphorylated in response to C5a or after stimulation of cells with phorbol esters. Expressed on monocytes, granulocytes, dendritic cells, astrocytes and microglia.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: cell surface; basolateral plasma membrane; integral to plasma membrane; apical part of cell; cytoplasmic membrane-bound vesicle; plasma membrane

Molecular Function: complement component C5a receptor activity; complement component C5a binding; C5a anaphylatoxin receptor activity

Biological Process: neutrophil chemotaxis; organ regeneration; sensory perception of chemical stimulus; activation of MAPK activity; apoptosis; response to lipopolysaccharide; chemotaxis; cell proliferation in hindbrain; signal transduction; mRNA transcription from RNA polymerase II promoter; elevation of cytosolic calcium ion concentration; defense response to Gram-positive bacterium; phospholipase C activation; response to peptidoglycan; cellular defense response; immune response; negative regulation of neuron apoptosis; inflammatory response; positive regulation of epithelial cell proliferation

Research Articles on OPRPN

Similar Products

Product Notes

The OPRPN c5ar1 (Catalog #AAA3220702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OPRPN Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OPRPN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OPRPN c5ar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFNYTTPDYG HYDDKDTLDL NTPVDKTSNT LRVPDILALV IFAVVFLVGV. It is sometimes possible for the material contained within the vial of "OPRPN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.