Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RABAC1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RABAC1 Polyclonal Antibody | anti-RABAC1 antibody

RABAC1 Antibody - N-terminal region

Gene Names
RABAC1; PRA1; YIP3; PRAF1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RABAC1; Polyclonal Antibody; RABAC1 Antibody - N-terminal region; anti-RABAC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVD
Sequence Length
185
Applicable Applications for anti-RABAC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RABAC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RABAC1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RABAC1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RABAC1 antibody
General Rab protein regulator required for vesicle formation from the Golgi complex. May control vesicle docking and fusion by mediating the action of Rab GTPases to the SNARE complexes. In addition it inhibits the removal of Rab GTPases from the membrane by GDI.
Product Categories/Family for anti-RABAC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20 kDa
NCBI Official Full Name
prenylated Rab acceptor protein 1
NCBI Official Synonym Full Names
Rab acceptor 1
NCBI Official Symbol
RABAC1
NCBI Official Synonym Symbols
PRA1; YIP3; PRAF1
NCBI Protein Information
prenylated Rab acceptor protein 1
UniProt Protein Name
Prenylated Rab acceptor protein 1
UniProt Gene Name
RABAC1
UniProt Synonym Gene Names
PRA1; PRAF1
UniProt Entry Name
PRAF1_HUMAN

Uniprot Description

RABAC1: General Rab protein regulator required for vesicle formation from the Golgi complex. May control vesicle docking and fusion by mediating the action of Rab GTPases to the SNARE complexes. In addition it inhibits the removal of Rab GTPases from the membrane by GDI. Belongs to the PRA1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: Golgi apparatus; synaptic vesicle; membrane; integral to membrane; plasma membrane; cell junction

Molecular Function: protein C-terminus binding; identical protein binding; protein binding

Research Articles on RABAC1

Similar Products

Product Notes

The RABAC1 rabac1 (Catalog #AAA3219996) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RABAC1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABAC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RABAC1 rabac1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAAQKDQQKD AEAEGLSGTT LLPKLIPSGA GREWLERRRA TIRPWSTFVD. It is sometimes possible for the material contained within the vial of "RABAC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.