Western Blot (WB)
(Western Blot detection against Immunogen (34.58kD).)
Mouse anti-Human RABAC1 Monoclonal Antibody | anti-RABAC1 antibody
RABAC1 (PRA1, PRAF1, Prenylated Rab Acceptor Protein 1, PRA1 Family Protein 1) (Biotin)
Gene Names
RABAC1; PRA1; YIP3; PRAF1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RABAC1; Monoclonal Antibody; RABAC1 (PRA1; PRAF1; Prenylated Rab Acceptor Protein 1; PRA1 Family Protein 1) (Biotin); anti-RABAC1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A4
Specificity
Recognizes human RABAC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
750
Applicable Applications for anti-RABAC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-77 from RABAC1 (NP_006414) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.58kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.58kD).)
Testing Data
(Detection limit for recombinant GST tagged RABAC1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RABAC1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-RABAC1 antibody
RABAC1 is general Rab protein regulator required for vesicle formation from the Golgi complex. May control vesicle docking and fusion by mediating the action of Rab GTPases to the SNARE complexes. In addition it inhibits the removal of Rab GTPases from the membrane by GDI.
Product Categories/Family for anti-RABAC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens Rab acceptor 1 (RABAC1), mRNA
NCBI Official Synonym Full Names
Rab acceptor 1
NCBI Official Symbol
RABAC1
NCBI Official Synonym Symbols
PRA1; YIP3; PRAF1
NCBI Protein Information
prenylated Rab acceptor protein 1
UniProt Protein Name
Prenylated Rab acceptor protein 1
Protein Family
UniProt Gene Name
RABAC1
UniProt Synonym Gene Names
PRA1; PRAF1
UniProt Entry Name
PRAF1_HUMAN
Uniprot Description
RABAC1: General Rab protein regulator required for vesicle formation from the Golgi complex. May control vesicle docking and fusion by mediating the action of Rab GTPases to the SNARE complexes. In addition it inhibits the removal of Rab GTPases from the membrane by GDI. Belongs to the PRA1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 19q13.2
Cellular Component: Golgi apparatus; synaptic vesicle; membrane; integral to membrane; plasma membrane; cell junction
Molecular Function: protein C-terminus binding; identical protein binding; protein binding
Research Articles on RABAC1
Similar Products
Product Notes
The RABAC1 rabac1 (Catalog #AAA6143885) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RABAC1 (PRA1, PRAF1, Prenylated Rab Acceptor Protein 1, PRA1 Family Protein 1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABAC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RABAC1 rabac1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RABAC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
