14-3-3 protein sigma Recombinant Protein | SFN recombinant protein

Recombinant Human 14-3-3 protein sigma

Cat. Num. AAA967183

• Gene Names: SFN; YWHAS
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 14-3-3 protein sigma; Recombinant Human 14-3-3 protein sigma; Epithelial cell marker protein 1; Stratifin; SFN recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-248aa; Full Length
• Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
• Sequence Length: 248

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SFN recombinant protein

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.

Product Categories/Family for SFN recombinant protein

Neuroscience

References

Complementary DNA cloning of a novel epithelial cell marker protein, HME1, that may be down-regulated in neoplastic mammary cells.Prasad G.L., Valverius E.M., McDuffie E., Cooper H.L.Cell Growth Differ. 3:507-513(1992) Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway.Leffers H., Madsen P., Rasmussen H.H., Honore B., Andersen A.H., Walbum E., Vandekerckhove J., Celis J.E.J. Mol. Biol. 231:982-998(1993) 14-3-3 sigma is a p53-regulated inhibitor of G2/M progression.Hermeking H., Lengauer C., Polyak K., He T.-C., Zhang L., Thiagalingam S., Kinzler K.W., Vogelstein B.Mol. Cell 1:3-11(1997) Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.Rasmussen H.H., van Damme J., Puype M., Gesser B., Celis J.E., Vandekerckhove J.Electrophoresis 13:960-969(1992) Exportin 7 defines a novel general nuclear export pathway.Mingot J.-M., Bohnsack M.T., Jaekle U., Goerlich D.EMBO J. 23:3227-3236(2004) A probability-based approach for high-throughput protein phosphorylation analysis and site localization.Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.Nat. Biotechnol. 24:1285-1292(2006) CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2.Yang W., Dicker D.T., Chen J., El-Deiry W.S.Cell Cycle 7:670-682(2008) Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein.Brummer T., Larance M., Herrera Abreu M.T., Lyons R.J., Timpson P., Emmerich C.H., Fleuren E.D.G., Lehrbach G.M., Schramek D., Guilhaus M., James D.E., Daly R.J.EMBO J. 27:2305-2316(2008) Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.Mol. Cell 31:438-448(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Interaction of Akt-phosphorylated SRPK2 with 14-3-3 mediates cell cycle and cell death in neurons.Jang S.W., Liu X., Fu H., Rees H., Yepes M., Levey A., Ye K.J. Biol. Chem. 284:24512-24525(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) COP9 signalosome subunit 6 stabilizes COP1, which functions as an E3 ubiquitin ligase for 14-3-3sigma.Choi H.H., Gully C., Su C.H., Velazquez-Torres G., Chou P.C., Tseng C., Zhao R., Phan L., Shaiken T., Chen J., Yeung S.C., Lee M.H.Oncogene 30:4791-4801(2011) A structural basis for 14-3-3sigma functional specificity.Wilker E.W., Grant R.A., Artim S.C., Yaffe M.B.J. Biol. Chem. 280:18891-18898(2005) Identification and structural characterization of two 14-3-3 binding sites in the human peptidylarginine deiminase type VI.Rose R., Rose M., Ottmann C.J. Struct. Biol. 180:65-72(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 5454052
• NCBI GeneID: 2810
• NCBI Accession #: NP_006133.1
• NCBI GenBank Nucleotide #: NM_006142.3
• UniProt Accession #: P31947; Q6FH30; Q6FH51; Q96DH0
• Molecular Weight: 54.8 kDa
• NCBI Official Full Name: 14-3-3 protein sigma
• NCBI Official Synonym Full Names: stratifin
• NCBI Official Symbol: SFN
• NCBI Official Synonym Symbols: YWHAS
• NCBI Protein Information: 14-3-3 protein sigma
• UniProt Protein Name: 14-3-3 protein sigma
• Protein Family: 14-3-3 protein
• UniProt Gene Name: SFN
• UniProt Synonym Gene Names: HME1
• UniProt Entry Name: 1433S_HUMAN

NCBI Description

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017]

Uniprot Description

14-3-3 sigma: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. Homodimer. Interacts with KRT17 and SAMSN1. Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, VPS35 and SFN. Interacts with GAB2. Interacts with SRPK2. Present mainly in tissues enriched in stratified squamous keratinizing epithelium. Belongs to the 14-3-3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: cytoplasm; cytoplasmic vesicle membrane; cytosol; extracellular space; mitochondrion; nucleus

Molecular Function: phosphoprotein binding; protein binding; protein domain specific binding; protein kinase binding; protein kinase C inhibitor activity

Biological Process: apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; gene expression; keratinization; negative regulation of caspase activity; negative regulation of protein kinase activity; positive regulation of cell growth; positive regulation of epidermal cell differentiation; positive regulation of protein export from nucleus; programmed cell death; regulation of cyclin-dependent protein kinase activity; regulation of epidermal cell division; release of cytochrome c from mitochondria; signal transduction; small GTPase mediated signal transduction; transcription initiation from RNA polymerase II promoter