Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VRK2 antibody Titration: 1 ug/mLSample Type: Human HCT116 Whole Cell)

Rabbit anti-Human VRK2 Polyclonal Antibody | anti-VRK2 antibody

VRK2 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VRK2; Polyclonal Antibody; VRK2 Antibody - middle region; anti-VRK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGH
Sequence Length
397
Applicable Applications for anti-VRK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human VRK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VRK2 antibody Titration: 1 ug/mLSample Type: Human HCT116 Whole Cell)

Western Blot (WB) (WB Suggested Anti-VRK2 antibody Titration: 1 ug/mLSample Type: Human HCT116 Whole Cell)
Related Product Information for anti-VRK2 antibody
This is a rabbit polyclonal antibody against VRK2. It was validated on Western Blot

Target Description: This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. The encoded protein acts as an effector of signaling pathways that regulate apoptosis and tumor cell growth. Variants in this gene have been associated with schizophrenia. Alternative splicing results in multiple transcript variants that differ in their subcellular localization and biological activity.
Product Categories/Family for anti-VRK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
serine/threonine-protein kinase VRK2 isoform 1
NCBI Official Synonym Full Names
VRK serine/threonine kinase 2
NCBI Official Symbol
VRK2
NCBI Protein Information
serine/threonine-protein kinase VRK2
UniProt Protein Name
Serine/threonine-protein kinase VRK2
UniProt Gene Name
VRK2
UniProt Entry Name
VRK2_HUMAN

NCBI Description

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. The encoded protein acts as an effector of signaling pathways that regulate apoptosis and tumor cell growth. Variants in this gene have been associated with schizophrenia. Alternative splicing results in multiple transcript variants that differ in their subcellular localization and biological activity. [provided by RefSeq, Jan 2014]

Uniprot Description

VRK2: a widely expressed serine/threonine kinase of the CK1 group. A single-pass type IV membrane protein. Highly expressed in fetal liver, skeletal muscle, pancreas, heart, peripheral blood leukocytes and testis. Modulates the stress response to hypoxia mediated by TAK1. Interacts with JIP1, inhibiting mitogen-activated protein kinase (MAPK) signaling. Interacts with RAN, inhibiting its autophosphorylation. Five human isoforms produced by alternative splicing have been reported. Isoform 1 has a C-terminal hydrophobic region that that associates with the endoplasmic reticulum and mitochondria, colocalizing with calreticulin, calnexin, and mitochondrial markers. Its interaction with JIP1 modulates the stress response to hypoxia and cytokines such as IL1B. Inhibition of signal transmission mediated by the assembly of JIP1-MAPK complexes reduces JNK phosphorylation and JUN-dependent transcription. Phosphorylates p53 and BAF, inhibiting the latter's ability to bind DNA and reduces its binding to LEM domain-containing proteins. Downregulates the transactivation of transcription induced by HER2, HRAS, BRAF, and MEK1. Blocks the phosphorylation of ERK in response to HER2 and HRAS. Interacts with Epstein-Barr virus BHRF1, protecting cells from apoptosis. Interacts with TAK1, MKK7, MEK1, KSR, RAN and JIP1. Its expression in breast carcinomas inversely correlates with the expression of HER2. Isoform 2 is detected in both the cytoplasm and the nucleus. Phosphorylates p53, reducing its ubiquitination by MDM2 and promoting its acetylation by EP300, thereby increasing the stability and activity of p53.

Protein type: Membrane protein, integral; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CK1; EC 2.7.11.1; CK1 group; VRK family

Chromosomal Location of Human Ortholog: 2p16.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; cytoplasm; mitochondrial membrane; integral to membrane; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: regulation of cell shape; peptidyl-serine phosphorylation; Wnt receptor signaling pathway; viral reproduction; protein amino acid autophosphorylation; regulation of MAPKKK cascade; endocytosis; protein amino acid phosphorylation

Research Articles on VRK2

Similar Products

Product Notes

The VRK2 vrk2 (Catalog #AAA3219636) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VRK2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VRK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VRK2 vrk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EYVHGDIKAA NLLLGYKNPD QVYLADYGLS YRYCPNGNHK QYQENPRKGH. It is sometimes possible for the material contained within the vial of "VRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.