Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LPHN1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit ADGRL1 Polyclonal Antibody | anti-ADGRL1 antibody

ADGRL1 Antibody - C-terminal region

Gene Names
ADGRL1; CL1; LEC2; CIRL1; LPHN1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADGRL1; Polyclonal Antibody; ADGRL1 Antibody - C-terminal region; anti-ADGRL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK
Sequence Length
839
Applicable Applications for anti-ADGRL1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LPHN1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-LPHN1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-ADGRL1 antibody
This is a rabbit polyclonal antibody against LPHN1. It was validated on Western Blot

Target Description: This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.
Product Categories/Family for anti-ADGRL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
LPHN1 protein, partial
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor L1
NCBI Official Symbol
ADGRL1
NCBI Official Synonym Symbols
CL1; LEC2; CIRL1; LPHN1
NCBI Protein Information
adhesion G protein-coupled receptor L1
UniProt Protein Name
Latrophilin-1
UniProt Gene Name
LPHN1
UniProt Synonym Gene Names
KIAA0821; LEC2; CIRL-1
UniProt Entry Name
LPHN1_HUMAN

NCBI Description

This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]

Uniprot Description

latrophilin 1: Calcium-independent receptor of high affinity for alpha- latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor propably implicated in the regulation of exocytosis. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 2; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: presynaptic membrane; neuron projection; growth cone; axon; integral to membrane; plasma membrane; synapse; cell junction

Molecular Function: G-protein coupled receptor activity; protein binding; latrotoxin receptor activity; cell adhesion molecule binding; carbohydrate binding

Biological Process: heterophilic cell adhesion; G-protein coupled receptor protein signaling pathway

Research Articles on ADGRL1

Similar Products

Product Notes

The ADGRL1 lphn1 (Catalog #AAA3216915) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADGRL1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADGRL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADGRL1 lphn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSLRSGDFPP GDGGPEPPRG RNLADAAAFE KMIISELVHN NLRGSSSAAK. It is sometimes possible for the material contained within the vial of "ADGRL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.