Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of K-562 cells, using mTOR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

Rabbit mTOR Polyclonal Antibody | anti-mTOR antibody

mTOR Rabbit pAb

Gene Names
MTOR; FRAP; FRAP1; FRAP2; RAFT1; RAPT1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
mTOR; Polyclonal Antibody; mTOR Rabbit pAb; FRAP; FRAP1; FRAP2; RAFT1; RAPT1; SKS; MTOR; anti-mTOR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
Applicable Applications for anti-mTOR antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation: WB: Human
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1).
Cellular Location
Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Golgi apparatus membrane, Lysosome, Mitochondrion outer membrane, Nucleus, PML body, Peripheral membrane protein
Positive Samples
K-562
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of K-562 cells, using mTOR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

Western Blot (WB) (Western blot analysis of extracts of K-562 cells, using mTOR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
Related Product Information for anti-mTOR antibody
Background: The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
288,892 Da
NCBI Official Full Name
serine/threonine-protein kinase mTOR
NCBI Official Synonym Full Names
mechanistic target of rapamycin (serine/threonine kinase)
NCBI Official Symbol
MTOR
NCBI Official Synonym Symbols
FRAP; FRAP1; FRAP2; RAFT1; RAPT1
NCBI Protein Information
serine/threonine-protein kinase mTOR; rapamycin target protein 1; mammalian target of rapamycin; rapamycin and FKBP12 target 1; FKBP-rapamycin associated protein; rapamycin associated protein FRAP2; FKBP12-rapamycin complex-associated protein 1; FK506 bin
UniProt Protein Name
Serine/threonine-protein kinase mTOR
UniProt Gene Name
MTOR
UniProt Synonym Gene Names
FRAP; FRAP1; FRAP2; RAFT1; RAPT1; mTOR
UniProt Entry Name
MTOR_HUMAN

NCBI Description

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

mTOR: an atypical kinase belonging to the PIKK family of kinases. Is the catalytic subunit of two protein complexes, mTORC1 and mTORC2. mTORC1 activates S6K and inactivates 4E-BP1, up-regulating protein synthesis. mTORC1 contains Raptor, a positive regulatory subunit and scaffold for recruiting substrates, two negative regulators, PRAS40 and DEPTOR, and mLST8; it is a target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. mTORC2, a downstream effector of PI3K, is insensitive to rapamycin and activates Akt by phosphorylating a key activation site. mTORC2 contains regulatory subunits Rictor and mSIN1, PROTOR, mLST8, and the negative regulator DEPTOR. mTORC1 suppresses PI3K activity via a strong negative feedback loop that involves S6K1. Inhibiting mTORC1 ablates this negative feedback loop and potentiates PI3K signaling. Known inhibitors of mTOR include rapamycin, temsirolimus (CCI-779).

Protein type: Autophagy; Kinase, protein; EC 2.7.11.1; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); Protein kinase, atypical; ATYPICAL group; PIKK family; FRAP subfamily

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: endoplasmic reticulum membrane; PML body; lysosomal membrane; lysosome; dendrite; endomembrane system; cytosol; nucleoplasm; Golgi membrane; mitochondrial outer membrane; membrane; cell soma; cytoplasm; TORC2 complex; nucleus; phosphoinositide 3-kinase complex

Molecular Function: protein dimerization activity; protein domain specific binding; protein serine/threonine kinase activity; protein binding; ribosome binding; phosphoprotein binding; kinase activity; drug binding; ATP binding

Biological Process: negative regulation of autophagy; regulation of myelination; TOR signaling pathway; positive regulation of translation; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; regulation of glycogen biosynthetic process; negative regulation of cell size; signal transduction; protein amino acid phosphorylation; germ cell development; negative regulation of macroautophagy; cellular response to nutrient levels; positive regulation of stress fiber formation; regulation of carbohydrate utilization; response to stress; protein catabolic process; cell growth; regulation of response to food; response to nutrient; epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; peptidyl-threonine phosphorylation; positive regulation of lipid biosynthetic process; negative regulation of NFAT protein import into nucleus; response to amino acid stimulus; double-strand break repair via homologous recombination; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; peptidyl-serine phosphorylation; positive regulation of actin filament polymerization; regulation of actin cytoskeleton organization and biogenesis; T cell costimulation; insulin receptor signaling pathway; ruffle organization and biogenesis; innate immune response; regulation of fatty acid beta-oxidation; positive regulation of transcription from RNA polymerase III promoter; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; regulation of protein kinase activity; phosphorylation; growth

Research Articles on mTOR

Similar Products

Product Notes

The mTOR mtor (Catalog #AAA9142046) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The mTOR Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's mTOR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Human. Researchers should empirically determine the suitability of the mTOR mtor for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CHTVMEVLRE HKDSVMAVLE AFVYDPLLNW RLMDTNTKGN KRSRTRTDSY SAGQSVEILD GVELGEPAHK KTGTTVPESI HSFIGDGLVK PEALNKKAIQ I. It is sometimes possible for the material contained within the vial of "mTOR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.