Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LILRA3Antibody Dilution: 1.0ug/mlSample Type: Human Kidney)

Rabbit anti-Human LILRA3 Polyclonal Antibody | anti-LILRA3 antibody

LILRA3 antibody - C-terminal region

Gene Names
LILRA3; HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LILRA3; Polyclonal Antibody; LILRA3 antibody - C-terminal region; anti-LILRA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP
Sequence Length
439
Applicable Applications for anti-LILRA3 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LILRA3Antibody Dilution: 1.0ug/mlSample Type: Human Kidney)

Western Blot (WB) (Host: RabbitTarget Name: LILRA3Antibody Dilution: 1.0ug/mlSample Type: Human Kidney)

Western Blot (WB)

(Host: RabbitTarget Name: LILRA3Sample Type: Human OVCAR-3Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

Western Blot (WB) (Host: RabbitTarget Name: LILRA3Sample Type: Human OVCAR-3Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Related Product Information for anti-LILRA3 antibody
This is a rabbit polyclonal antibody against LILRA3. It was validated on Western Blot

Target Description: Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.
Product Categories/Family for anti-LILRA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily A member 3 isoform 1
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor A3
NCBI Official Symbol
LILRA3
NCBI Official Synonym Symbols
HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily A member 3
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily A member 3
UniProt Gene Name
LILRA3
UniProt Synonym Gene Names
ILT6; LIR4; ILT-6; LIR-4

NCBI Description

This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]

Uniprot Description

Acts as soluble receptor for class I MHC antigens. Binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1 or LILRB2. Binds with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes.

Research Articles on LILRA3

Similar Products

Product Notes

The LILRA3 lilra3 (Catalog #AAA3216739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LILRA3 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LILRA3 lilra3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AADSPLRLKS KRQSHKYQAE FPMSPVTSAH AGTYRCYGSL SSNPYLLTHP. It is sometimes possible for the material contained within the vial of "LILRA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.