Western Blot (WB)
(Host: RabbitTarget Name: LALBAAntibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)
Rabbit LALBA Polyclonal Antibody | anti-LALBA antibody
LALBA antibody - N-terminal region
Gene Names
LALBA; LYZG
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LALBA; Polyclonal Antibody; LALBA antibody - N-terminal region; anti-LALBA antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQ
Sequence Length
142
Applicable Applications for anti-LALBA antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 92%; Horse: 79%; Human: 100%; Mouse: 85%; Rat: 85%; Sheep: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: LALBAAntibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)
Western Blot (WB)
(Host: RabbitTarget Name: LALBAAntibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)
Related Product Information for anti-LALBA antibody
This is a rabbit polyclonal antibody against LALBA. It was validated on Western Blot
Target Description: This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
Target Description: This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
Product Categories/Family for anti-LALBA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
alpha-lactalbumin
NCBI Official Synonym Full Names
lactalbumin alpha
NCBI Official Symbol
LALBA
NCBI Official Synonym Symbols
LYZG
NCBI Protein Information
alpha-lactalbumin
UniProt Protein Name
Alpha-lactalbumin
Protein Family
UniProt Gene Name
LALBA
UniProt Synonym Gene Names
LYZL7
UniProt Entry Name
LALBA_HUMAN
NCBI Description
This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. [provided by RefSeq, Jul 2008]
Research Articles on LALBA
Similar Products
Product Notes
The LALBA lalba (Catalog #AAA3216647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LALBA antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's LALBA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LALBA lalba for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCELSQLLKD IDGYGGIALP ELICTMFHTS GYDTQAIVEN NESTEYGLFQ. It is sometimes possible for the material contained within the vial of "LALBA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
