Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RNF113A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Rabbit RNF113A Polyclonal Antibody | anti-RNF113A antibody

RNF113A antibody - middle region

Gene Names
RNF113A; TTD5; Cwc24; RNF113; ZNF183
Reactivity
Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF113A; Polyclonal Antibody; RNF113A antibody - middle region; anti-RNF113A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD
Sequence Length
343
Applicable Applications for anti-RNF113A antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNF113A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RNF113A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-RNF113A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-RNF113A antibody
This is a rabbit polyclonal antibody against RNF113A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact function of RNF113A remains unknown.
Product Categories/Family for anti-RNF113A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF113A
NCBI Official Synonym Full Names
ring finger protein 113A
NCBI Official Symbol
RNF113A
NCBI Official Synonym Symbols
TTD5; Cwc24; RNF113; ZNF183
NCBI Protein Information
E3 ubiquitin-protein ligase RNF113A
UniProt Protein Name
RING finger protein 113A
Protein Family
UniProt Gene Name
RNF113A
UniProt Synonym Gene Names
RNF113; ZNF183
UniProt Entry Name
R113A_HUMAN

NCBI Description

This intronless gene encodes a protein which contains a C3H1-type zinc finger domain and a C3HC4 Ring-type (Really Interesting New Gene-type) zinc finger domain. The Ring-type zinc finger domain is identified in various tumor suppressors, DNA repair genes and cytokine receptor-associated molecules, and is probably involved in mediating protein-protein interactions. [provided by RefSeq, May 2010]

Uniprot Description

ZNF183:

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: Xq24

Molecular Function: protein binding; zinc ion binding

Disease: Trichothiodystrophy 5, Nonphotosensitive

Research Articles on RNF113A

Similar Products

Product Notes

The RNF113A rnf113a (Catalog #AAA3204327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF113A antibody - middle region reacts with Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's RNF113A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF113A rnf113a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQHFRTTPRC YVCDQQTNGV FNPAKELIAK LEKHRATGEG GASDLPEDPD. It is sometimes possible for the material contained within the vial of "RNF113A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.