Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RILP AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Rabbit anti-Human RILP Polyclonal Antibody | anti-RILP antibody

RILP antibody - C-terminal region

Gene Names
RILP; PP10141
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RILP; Polyclonal Antibody; RILP antibody - C-terminal region; anti-RILP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCL
Sequence Length
401
Applicable Applications for anti-RILP antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RILP AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-RILP AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Related Product Information for anti-RILP antibody
This is a rabbit polyclonal antibody against RILP. It was validated on Western Blot

Target Description: This gene encodes a lysosomal protein that interacts with RAB7, a small GTPase that controls transport to endocytic degradative compartments. Studies using mutant forms of the two proteins suggest that this protein represents a downstream effector for RAB7, and both proteins act together in the regulation of late endocytic traffic. A unique region of this protein has also been shown to be involved in the regulation of lysosomal morphology.
Product Categories/Family for anti-RILP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
rab-interacting lysosomal protein
NCBI Official Synonym Full Names
Rab interacting lysosomal protein
NCBI Official Symbol
RILP
NCBI Official Synonym Symbols
PP10141
NCBI Protein Information
rab-interacting lysosomal protein
UniProt Protein Name
Rab-interacting lysosomal protein
Protein Family
UniProt Gene Name
RILP
UniProt Entry Name
RILP_HUMAN

NCBI Description

This gene encodes a lysosomal protein that interacts with RAB7, a small GTPase that controls transport to endocytic degradative compartments. Studies using mutant forms of the two proteins suggest that this protein represents a downstream effector for RAB7, and both proteins act together in the regulation of late endocytic traffic. A unique region of this protein has also been shown to be involved in the regulation of lysosomal morphology. [provided by RefSeq, Sep 2011]

Uniprot Description

RILP: Rab effector playing a role in late endocytic transport to degradative compartments. Involved in the regulation of lysosomal morphology and distribution. Induces recruitment of dynein-dynactin motor complexes to Rab7A-containing late endosome and lysosome compartments. Promotes centripetal migration of phagosomes and the fusion of phagosomes with the late endosomes and lysosomes. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: phagocytic vesicle membrane; protein complex; mitochondrion; lysosomal membrane; late endosome membrane; lysosome; late endosome

Molecular Function: protein binding; Rab GTPase binding

Biological Process: protein transport; antigen processing and presentation of exogenous peptide antigen via MHC class II; endosome to lysosome transport

Research Articles on RILP

Similar Products

Product Notes

The RILP rilp (Catalog #AAA3216312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RILP antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RILP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RILP rilp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGLWYRGKAE SSEDETSSPA PSKLGGEEEA QPQSPAPDPP CSALHEHLCL. It is sometimes possible for the material contained within the vial of "RILP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.