Western Blot (WB)
(WB Suggested Anti-STXBP4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Rabbit anti-Human STXBP4 Polyclonal Antibody | anti-STXBP4 antibody
STXBP4 Antibody - N-terminal region
Gene Names
STXBP4; Synip
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STXBP4; Polyclonal Antibody; STXBP4 Antibody - N-terminal region; anti-STXBP4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVNKESMIGVSFEEAKSIITGAKLRLESAWEIAFIRQKSDNIQPENLSCT
Sequence Length
553
Applicable Applications for anti-STXBP4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human STXBP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-STXBP4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-STXBP4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-STXBP4 antibody
This is a rabbit polyclonal antibody against STXBP4. It was validated on Western Blot
Target Description: STXBP4 plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. STXBP4 inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. STXBP4 may also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.
Target Description: STXBP4 plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. STXBP4 inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. STXBP4 may also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.
Product Categories/Family for anti-STXBP4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
syntaxin-binding protein 4
NCBI Official Synonym Full Names
syntaxin binding protein 4
NCBI Official Symbol
STXBP4
NCBI Official Synonym Symbols
Synip
NCBI Protein Information
syntaxin-binding protein 4
UniProt Protein Name
Syntaxin-binding protein 4
Protein Family
UniProt Gene Name
STXBP4
UniProt Synonym Gene Names
STX4-interacting protein; Synip
UniProt Entry Name
STXB4_HUMAN
Uniprot Description
STXBP4: Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose. Interacts with STX4A. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 17q22
Cellular Component: nucleoplasm; intermediate filament cytoskeleton; cytoplasm
Molecular Function: protein binding; syntaxin binding
Biological Process: protein stabilization; insulin receptor signaling pathway; glucose transport; response to DNA damage stimulus; protein targeting
Research Articles on STXBP4
Similar Products
Product Notes
The STXBP4 stxbp4 (Catalog #AAA3216932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STXBP4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STXBP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STXBP4 stxbp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVNKESMIGV SFEEAKSIIT GAKLRLESAW EIAFIRQKSD NIQPENLSCT. It is sometimes possible for the material contained within the vial of "STXBP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
