Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUTF2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellNUTF2 is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit NUTF2 Polyclonal Antibody | anti-NUTF2 antibody

NUTF2 Antibody - middle region

Gene Names
NUTF2; NTF2; PP15; NTF-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUTF2; Polyclonal Antibody; NUTF2 Antibody - middle region; anti-NUTF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAW
Sequence Length
127
Applicable Applications for anti-NUTF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NUTF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUTF2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellNUTF2 is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-NUTF2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellNUTF2 is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-NUTF2 antibody
This is a rabbit polyclonal antibody against NUTF2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cytosolic factor that facilitates protein transport into the nucleus. It interacts with the nuclear pore complex glycoprotein p62. This encoded protein acts at a relative late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. It is thought to be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.
Product Categories/Family for anti-NUTF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
nuclear transport factor 2
NCBI Official Synonym Full Names
nuclear transport factor 2
NCBI Official Symbol
NUTF2
NCBI Official Synonym Symbols
NTF2; PP15; NTF-2
NCBI Protein Information
nuclear transport factor 2
UniProt Protein Name
Nuclear transport factor 2
UniProt Gene Name
NUTF2
UniProt Synonym Gene Names
NTF2; NTF-2; PP15
UniProt Entry Name
NTF2_HUMAN

NCBI Description

This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. [provided by RefSeq, Apr 2016]

Uniprot Description

NUTF2: Facilitates protein transport into the nucleus. Interacts with the nucleoporin p62 and with Ran. Acts at a relatively late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import. Homodimer.

Protein type: Nuclear import

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nuclear pore; cytosol

Molecular Function: protein binding; transporter activity

Biological Process: protein export from nucleus

Research Articles on NUTF2

Similar Products

Product Notes

The NUTF2 nutf2 (Catalog #AAA3216575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUTF2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NUTF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUTF2 nutf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIQHSITAQD HQPTPDSCII SMVVGQLKAD EDPIMGFHQM FLLKNINDAW. It is sometimes possible for the material contained within the vial of "NUTF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.