Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TF AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Rabbit anti-Human TF Polyclonal Antibody | anti-TF antibody

TF antibody - C-terminal region

Gene Names
TF; TFQTL1; PRO1557; PRO2086; HEL-S-71p
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TF; Polyclonal Antibody; TF antibody - C-terminal region; anti-TF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGK
Sequence Length
698
Applicable Applications for anti-TF antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TF AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Western Blot (WB) (WB Suggested Anti-TF AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)
Related Product Information for anti-TF antibody
This is a rabbit polyclonal antibody against TF. It was validated on Western Blot

Target Description: This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
serotransferrin isoform 1
NCBI Official Synonym Full Names
transferrin
NCBI Official Symbol
TF
NCBI Official Synonym Symbols
TFQTL1; PRO1557; PRO2086; HEL-S-71p
NCBI Protein Information
serotransferrin
UniProt Protein Name
Serotransferrin
UniProt Gene Name
TF
UniProt Synonym Gene Names
Transferrin
UniProt Entry Name
TRFE_HUMAN

NCBI Description

This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq, Sep 2009]

Uniprot Description

TF: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. Defects in TF are the cause of atransferrinemia (ATRAF). Atransferrinemia is rare autosomal recessive disorder characterized by iron overload and hypochromic anemia. Belongs to the transferrin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: extracellular space; cell surface; early endosome; cytoplasmic membrane-bound vesicle; extracellular region; coated pit; recycling endosome; endocytic vesicle; perinuclear region of cytoplasm; apical plasma membrane; late endosome; basal plasma membrane; endosome membrane; vesicle

Molecular Function: protein binding; ferric iron binding; ubiquitin protein ligase binding

Biological Process: platelet activation; retinal homeostasis; platelet degranulation; cellular iron ion homeostasis; transferrin transport; blood coagulation; transmembrane transport

Disease: Atransferrinemia

Research Articles on TF

Similar Products

Product Notes

The TF tf (Catalog #AAA3215825) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TF antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TF tf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAGKCGLVPV LAENYNKSDN CEDTPEAGYF AVAVVKKSAS DLTWDNLKGK. It is sometimes possible for the material contained within the vial of "TF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.