Rabbit anti-Human VEGFA Polyclonal Antibody | anti-VEGFA antibody

VEGFA Antibody - C-terminal region

Cat. Num. AAA3215037

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: VEGFA; Polyclonal Antibody; VEGFA Antibody - C-terminal region; anti-VEGFA antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSL
• Sequence Length: 327

• Applicable Applications for anti-VEGFA antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human VEGFA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-VEGFA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: VEGFASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-VEGFA antibody

This is a rabbit polyclonal antibody against VEGFA. It was validated on Western Blot

Target Description: This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.

Product Categories/Family for anti-VEGFA antibody

Polyclonal; Cancer; Cell Adhesion; Growth Factors & Hormones; Apoptosis; Disease Related; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 324120930
• NCBI GeneID: 7422
• NCBI Accession #: NP_001191313.1
• NCBI GenBank Nucleotide #: NM_001204384.1
• UniProt Accession #: P15692
• Molecular Weight: 35kDa
• NCBI Official Full Name: vascular endothelial growth factor A isoform q
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A
• UniProt Protein Name: Vascular endothelial growth factor A
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN

NCBI Description

This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]

Uniprot Description

Function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Ref.27 Ref.30 Ref.33

Subunit structure: Homodimer; disulfide-linked. Also found as heterodimer with PGF

By similarity.

Subcellular location: Secreted. Note: VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. Ref.26 Ref.28 Ref.32

Tissue specificity: Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.

Induction: Regulated by growth factors, cytokines, gonadotropins, nitric oxide, hypoxia, hypoglycemia and oncogenic mutations.

Involvement in disease: Microvascular complications of diabetes 1 (MVCD1) [MIM:603933]: Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

Sequence similarities: Belongs to the PDGF/VEGF growth factor family.

Sequence caution: The sequence AAC63102.1 differs from that shown. Reason: Erroneous initiation. The sequence AAC63143.1 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.The sequence CAC19512.2 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.The sequence CAC19516.2 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.