Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CMA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysateCMA1 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit CMA1 Polyclonal Antibody | anti-CMA1 antibody

CMA1 antibody - C-terminal region

Gene Names
CMA1; CYH; MCT1; chymase
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CMA1; Polyclonal Antibody; CMA1 antibody - C-terminal region; anti-CMA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA
Sequence Length
247
Applicable Applications for anti-CMA1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CMA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CMA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysateCMA1 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-CMA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysateCMA1 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-CMA1 antibody
This is a rabbit polyclonal antibody against CMA1. It was validated on Western Blot

Target Description: CMA1 is a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Angiotensin II has been implicated in blood pressure control and in the pathogenesis of hypertension, cardiac hypertrophy, and heart failure. Thus, this gene product is a target for cardiovascular disease therapies.
Product Categories/Family for anti-CMA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
chymase isoform 1 preproprotein
NCBI Official Synonym Full Names
chymase 1
NCBI Official Symbol
CMA1
NCBI Official Synonym Symbols
CYH; MCT1; chymase
NCBI Protein Information
chymase
UniProt Protein Name
Chymase
Protein Family
UniProt Gene Name
CMA1
UniProt Synonym Gene Names
CYH; CYM
UniProt Entry Name
CMA1_HUMAN

NCBI Description

This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. [provided by RefSeq, Apr 2015]

Uniprot Description

CMA1: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. Belongs to the peptidase S1 family. Granzyme subfamily.

Protein type: Secreted, signal peptide; Protease; Secreted; EC 3.4.21.39

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: extracellular matrix; extracellular space; extracellular region; intracellular

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity; peptide binding

Biological Process: extracellular matrix disassembly; interleukin-1 beta biosynthetic process; positive regulation of angiogenesis; extracellular matrix organization and biogenesis; cellular protein metabolic process; midbrain development; regulation of inflammatory response; protein processing; angiotensin maturation; proteolysis

Research Articles on CMA1

Similar Products

Product Notes

The CMA1 cma1 (Catalog #AAA3214608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CMA1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CMA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CMA1 cma1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVKLRLMDPQ ACSHFRDFDH NLQLCVGNPR KTKSAFKGDS GGPLLCAGVA. It is sometimes possible for the material contained within the vial of "CMA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.