Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence: Dilution -- 3ug/mL)

Rabbit TAAR5 Polyclonal Antibody | anti-TAAR5 antibody

TAAR5 antibody - middle region

Gene Names
TAAR5; PNR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
TAAR5; Polyclonal Antibody; TAAR5 antibody - middle region; anti-TAAR5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA
Sequence Length
337
Applicable Applications for anti-TAAR5 antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TAAR5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence: Dilution -- 3ug/mL)

Immunofluorescence (IF) (Immunofluorescence: Dilution -- 3ug/mL)

Immunofluorescence (IF)

(Sample Type : Spinal Cord, ventral horns)

Immunofluorescence (IF) (Sample Type : Spinal Cord, ventral horns)

Western Blot (WB)

(WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateTAAR5 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateTAAR5 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-TAAR5 antibody
This is a rabbit polyclonal antibody against TAAR5. It was validated on Western Blot

Target Description: TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.
Product Categories/Family for anti-TAAR5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
trace amine-associated receptor 5
NCBI Official Synonym Full Names
trace amine associated receptor 5
NCBI Official Symbol
TAAR5
NCBI Official Synonym Symbols
PNR
NCBI Protein Information
trace amine-associated receptor 5
UniProt Protein Name
Trace amine-associated receptor 5
UniProt Gene Name
TAAR5
UniProt Synonym Gene Names
TaR-5; Trace amine receptor 5
UniProt Entry Name
TAAR5_PANTR

Uniprot Description

Olfactory receptor specific for trimethylamine, a trace amine. Also activated at lower level by dimethylethylamine. Trimethylamine is a bacterial metabolite found in some animal odors, and is a repulsive odor associated with bad breath and spoiled food. This receptor is probably mediated by the G(s)-class of G-proteins which activate adenylate cyclase ().

Research Articles on TAAR5

Similar Products

Product Notes

The TAAR5 taar5 (Catalog #AAA3214426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAAR5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAAR5 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the TAAR5 taar5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GWLNFPLFFV PCLIMISLYV KIFVVATRQA QQITTLSKSL AGAAKHERKA. It is sometimes possible for the material contained within the vial of "TAAR5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.