Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCG1Sample Type: Mouse MuscleAntibody Dilution: 1.0ug/ml)

Rabbit anti-Mouse Cacng1 Polyclonal Antibody | anti-CACNG1 antibody

Cacng1 Antibody - C-terminal

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
Cacng1; Polyclonal Antibody; Cacng1 Antibody - C-terminal; anti-CACNG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WIEHYYSWSFACACAAFILLFLGGLFLLLFSLPRMPQNPWESCMDAEPEH
Sequence Length
223
Applicable Applications for anti-CACNG1 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-Cacng1 antibody is: synthetic peptide directed towards the C-terminal of Mouse CCG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCG1Sample Type: Mouse MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCG1Sample Type: Mouse MuscleAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CACNG1 antibody
This is a rabbit polyclonal antibody against CCG1. It was validated on Western Blot
Product Categories/Family for anti-CACNG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
voltage-dependent calcium channel gamma-1 subunit
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, gamma subunit 1
NCBI Official Symbol
Cacng1
NCBI Protein Information
voltage-dependent calcium channel gamma-1 subunit
UniProt Protein Name
Voltage-dependent calcium channel gamma-1 subunit
UniProt Gene Name
Cacng1
UniProt Entry Name
CCG1_MOUSE

Uniprot Description

CACNG1: This protein is a subunit of the dihydropyridine (DHP) sensitive calcium channel. Plays a role in excitation-contraction coupling. The skeletal muscle DHP-sensitive Ca(2+) channel may function only as a multiple subunit complex. Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: membrane; cell; integral to membrane; voltage-gated calcium channel complex; intracellular

Molecular Function: voltage-gated calcium channel activity; calcium channel activity; voltage-gated ion channel activity

Biological Process: transport; calcium ion transport; ion transport

Research Articles on CACNG1

Similar Products

Product Notes

The CACNG1 cacng1 (Catalog #AAA3219134) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cacng1 Antibody - C-terminal reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Cacng1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CACNG1 cacng1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WIEHYYSWSF ACACAAFILL FLGGLFLLLF SLPRMPQNPW ESCMDAEPEH. It is sometimes possible for the material contained within the vial of "Cacng1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.