Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TFEBSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit TFEB Polyclonal Antibody | anti-TFEB antibody

TFEB antibody - middle region

Gene Names
TFEB; TCFEB; BHLHE35; ALPHATFEB
Reactivity
Cow, Dog, Goat, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TFEB; Polyclonal Antibody; TFEB antibody - middle region; anti-TFEB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
Sequence Length
476
Applicable Applications for anti-TFEB antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Goat: 79%; Horse: 85%; Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TFEB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TFEBSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TFEBSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TFEBSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TFEBSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TFEBSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TFEBSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TFEB Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-TFEB Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)
Related Product Information for anti-TFEB antibody
This is a rabbit polyclonal antibody against TFEB. It was validated on Western Blot

Target Description: The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific marker for renal neoplasms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
transcription factor EB isoform 2
NCBI Official Synonym Full Names
transcription factor EB
NCBI Official Symbol
TFEB
NCBI Official Synonym Symbols
TCFEB; BHLHE35; ALPHATFEB
NCBI Protein Information
transcription factor EB
UniProt Protein Name
Transcription factor EB
Protein Family
UniProt Gene Name
TFEB
UniProt Synonym Gene Names
BHLHE35; bHLHe35
UniProt Entry Name
TFEB_HUMAN

Uniprot Description

TFEB: Transcription factor that specifically recognizes and binds E-box sequences (3'-CANNTG-5'). Efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFE3 or MITF. In association with TFE3, activates the expression of CD40L in T-cells, thereby playing a role in T- cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity. Specifically recognizes and binds the CLEAR-box sequence (5'-GTCACGTGAC-3') present in the regulatory region of many lysosomal genes, leading to activate their expression. It thereby plays a central role in expression of lysosomal genes. Specifically recognizes the gamma-E3 box, a subset of E-boxes, present in the heavy-chain immunoglobulin enhancer. Plays a role in the signal transduction processes required for normal vascularization of the placenta. Homodimer and heterodimer; with TFE3 or MITF. Belongs to the MiT/TFE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: cytoplasm; nucleus

Molecular Function: protein dimerization activity; transcription factor activity

Biological Process: embryonic placenta development; transcription, DNA-dependent; regulation of transcription, DNA-dependent; lysosome organization and biogenesis; autophagy; positive regulation of transcription from RNA polymerase II promoter; humoral immune response; positive regulation of autophagy

Research Articles on TFEB

Similar Products

Product Notes

The TFEB tfeb (Catalog #AAA3213746) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFEB antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TFEB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TFEB tfeb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFSHSLSFGG REDEGPPGYP EPLAPGHGSP FPSLSKKDLD LMLLDDSLLP. It is sometimes possible for the material contained within the vial of "TFEB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.