Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit KLF8 Polyclonal Antibody | anti-KLF8 antibody

KLF8 antibody - N-terminal region

Gene Names
KLF8; BKLF3; ZNF741
Reactivity
Cow, Dog, Horse, Human, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KLF8; Polyclonal Antibody; KLF8 antibody - N-terminal region; anti-KLF8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
Sequence Length
359
Applicable Applications for anti-KLF8 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Horse: 77%; Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-KLF8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human Kidney)

Western Blot (WB) (WB Suggested Anti-KLF8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human Kidney)
Related Product Information for anti-KLF8 antibody
This is a rabbit polyclonal antibody against KLF8. It was validated on Western Blot and immunohistochemistry

Target Description: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
Krueppel-like factor 8 isoform 1
NCBI Official Synonym Full Names
Kruppel like factor 8
NCBI Official Symbol
KLF8
NCBI Official Synonym Symbols
BKLF3; ZNF741
NCBI Protein Information
Krueppel-like factor 8
UniProt Protein Name
Krueppel-like factor 8
Protein Family
UniProt Gene Name
KLF8
UniProt Synonym Gene Names
BKLF3; ZNF741
UniProt Entry Name
KLF8_HUMAN

NCBI Description

This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]

Uniprot Description

KLF8: Transcriptional repressor and activator. Binds to CACCC- boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK). Belongs to the Sp1 C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: Xp11.21

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on KLF8

Similar Products

Product Notes

The KLF8 klf8 (Catalog #AAA3200479) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF8 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's KLF8 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KLF8 klf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSFHKPKAPL QPASMLQAPI RPPKPQSSPQ TLVVSTSTSD MSTSANIPTV. It is sometimes possible for the material contained within the vial of "KLF8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.