Western Blot (WB)
(Host: RabbitTarget Name: R10B2Sample Type: Gallbladder Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human RSPH10B Polyclonal Antibody | anti-RSPH10B antibody
RSPH10B Antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RSPH10B; Polyclonal Antibody; RSPH10B Antibody - N-terminal region; anti-RSPH10B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN
Sequence Length
280
Applicable Applications for anti-RSPH10B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human R10B2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: R10B2Sample Type: Gallbladder Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: R10B2Sample Type: Gallbladder Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RSPH10B antibody
This is a rabbit polyclonal antibody against R10B2. It was validated on Western Blot
Product Categories/Family for anti-RSPH10B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30kDa
NCBI Official Full Name
radial spoke head 10 homolog B
NCBI Official Synonym Full Names
radial spoke head 10 homolog B2
NCBI Official Symbol
RSPH10B2
NCBI Protein Information
radial spoke head 10 homolog B2; radial spoke head 10 homolog B
UniProt Protein Name
Radial spoke head 10 homolog B2
Protein Family
UniProt Gene Name
RSPH10B2
UniProt Entry Name
R10B2_HUMAN
NCBI Description
This gene encodes a protein component of the radial spoke head in flagella and motile cilia. Eukaryotic flagella and motile cilia share a common 9 + 2 structure, in which nine peripheral microtubule doublets (MTDs) surround a central-pair of microtubules (CP), with radial spokes connecting the MTDs to the CP. The radial spoke is a multi-protein complex that works as a mechanochemical transducer between the CP and the MTDs. The radial spoke contributes to the regulation of the activity of dynein motors, and thus to flagellar motility. PMID: 22754630 provides a good review of radial spokes. [provided by RefSeq, Jul 2017]
Similar Products
Product Notes
The RSPH10B rsph10b2 (Catalog #AAA3212532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RSPH10B Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSPH10B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RSPH10B rsph10b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THTWFLKRIR SSQYPLRNEY IGEFVNGYRH GRGKFYYASG AMYDGEWVSN. It is sometimes possible for the material contained within the vial of "RSPH10B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
