Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZNF606Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ZNF606 Polyclonal Antibody | anti-ZNF606 antibody

ZNF606 Antibody - middle region

Gene Names
ZNF606; ZNF328
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF606; Polyclonal Antibody; ZNF606 Antibody - middle region; anti-ZNF606 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSY
Sequence Length
702
Applicable Applications for anti-ZNF606 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF606
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZNF606Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZNF606Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZNF606 antibody
This is a rabbit polyclonal antibody against ZNF606. It was validated on Western Blot
Product Categories/Family for anti-ZNF606 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
zinc finger protein 606 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 606
NCBI Official Symbol
ZNF606
NCBI Official Synonym Symbols
ZNF328
NCBI Protein Information
zinc finger protein 606
UniProt Protein Name
Zinc finger protein 606
Protein Family
UniProt Gene Name
ZNF606
UniProt Synonym Gene Names
KIAA1852; ZNF328
UniProt Entry Name
ZN606_HUMAN

NCBI Description

This gene encodes a zinc finger protein containing a Kruppel-associated box (KRAB) domain at its N-terminus, followed by contiguous C2H2 zinc finger motifs. The encoded protein is a nuclear protein that can act as a transcriptional repressor of growth factor-mediated signaling pathways in a reporter gene assay. This protein has been shown to interact with the SRY-box 9 gene product, and suppresses its transcriptional activity by inhibiting its DNA binding activity. Reduced expression of this gene promotes chondrocyte differentiation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]

Uniprot Description

Function: May act as a transcriptional repressor. Ref.6

Subcellular location: Nucleus Ref.6.

Tissue specificity: Widely expressed in adult and fetal tissues. Ref.6

Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 16 C2H2-type zinc fingers.Contains 1 KRAB domain.

Sequence caution: The sequence BAB47481.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on ZNF606

Similar Products

Product Notes

The ZNF606 znf606 (Catalog #AAA3201628) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF606 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF606 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF606 znf606 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IGTVEKAYKY NEWEKVFGYD SFLTQHTSTY TAEKPYDYNE CGTSFIWSSY. It is sometimes possible for the material contained within the vial of "ZNF606, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.