Western Blot (WB)
(Host: RabbitTarget Name: CAB39LSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human CAB39L Polyclonal Antibody | anti-CAB39L antibody
CAB39L Antibody - C-terminal region
Gene Names
CAB39L; MO2L; MO25-BETA; bA103J18.3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAB39L; Polyclonal Antibody; CAB39L Antibody - C-terminal region; anti-CAB39L antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIK
Sequence Length
280
Applicable Applications for anti-CAB39L antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CAB39L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CAB39LSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CAB39LSample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CAB39L antibody
This is a rabbit polyclonal antibody against CAB39L. It was validated on Western Blot
Product Categories/Family for anti-CAB39L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
calcium-binding protein 39-like
NCBI Official Synonym Full Names
calcium binding protein 39 like
NCBI Official Symbol
CAB39L
NCBI Official Synonym Symbols
MO2L; MO25-BETA; bA103J18.3
NCBI Protein Information
calcium-binding protein 39-like
UniProt Protein Name
Calcium-binding protein 39-like
Protein Family
UniProt Gene Name
CAB39L
UniProt Entry Name
CB39L_HUMAN
Uniprot Description
CAB39L: Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1. Belongs to the Mo25 family.
Chromosomal Location of Human Ortholog: 13q14.2
Cellular Component: cytosol
Biological Process: insulin receptor signaling pathway; cell cycle arrest
Research Articles on CAB39L
Similar Products
Product Notes
The CAB39L cab39l (Catalog #AAA3219322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAB39L Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAB39L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAB39L cab39l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVFVASPHKT QPIVEILLKN QPKLIEFLSS FQKERTDDEQ FADEKNYLIK. It is sometimes possible for the material contained within the vial of "CAB39L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
