Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGB3BPSample Type: Gallbladder Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Dog, Human ITGB3BP Polyclonal Antibody | anti-ITGB3BP antibody

ITGB3BP Antibody - N-terminal region

Gene Names
ITGB3BP; CENPR; NRIF3; TAP20; CENP-R; HSU37139
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGB3BP; Polyclonal Antibody; ITGB3BP Antibody - N-terminal region; anti-ITGB3BP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMML
Sequence Length
216
Applicable Applications for anti-ITGB3BP antibody
Western Blot (WB)
Homology
Dog: 91%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITGB3BP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGB3BPSample Type: Gallbladder Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGB3BPSample Type: Gallbladder Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ITGB3BP antibody
This is a rabbit polyclonal antibody against ITGB3BP. It was validated on Western Blot

Target Description: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
centromere protein R isoform 2
NCBI Official Synonym Full Names
integrin subunit beta 3 binding protein
NCBI Official Symbol
ITGB3BP
NCBI Official Synonym Symbols
CENPR; NRIF3; TAP20; CENP-R; HSU37139
NCBI Protein Information
centromere protein R
UniProt Protein Name
Centromere protein R
Protein Family
UniProt Gene Name
ITGB3BP
UniProt Synonym Gene Names
CENPR; NRIF3; CENP-R
UniProt Entry Name
CENPR_HUMAN

NCBI Description

This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

NRIF3: Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF- kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A- associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Homodimer; mediated by the coiled coil domain. Isoform 3, but not other isoforms, interacts with the cytoplasmic tail of integrin ITGB3. The relevance of the interaction with ITGB3 is however uncertain, since isoform 3 is mainly nuclear. Interacts with CCNA2 and MTA1. Interacts with NFKB1 NF-kappa-B subunit. Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and MLF1IP/CENPU. By estrogen. Widely expressed. Expressed in spleen, thymus, prostate, ovary, small intestine and white blood cells. Highly expressed in testis and colon. Isoform 4 is expressed in platelets, lymphocytes and granulocytes. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein C-terminus binding; signal transducer activity

Biological Process: mitosis; nucleosome assembly; DNA replication-independent nucleosome assembly at centromere; nerve growth factor receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of apoptosis; cell division; mitotic cell cycle; cell adhesion; signal transduction

Research Articles on ITGB3BP

Similar Products

Product Notes

The ITGB3BP itgb3bp (Catalog #AAA3211991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB3BP Antibody - N-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB3BP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGB3BP itgb3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QMSLFASPTS SEEQKHRNGL SNEKRKKLNH PSLTESKEST TKDNDEFMML. It is sometimes possible for the material contained within the vial of "ITGB3BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.