Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ITGB3BP Monoclonal Antibody | anti-ITGB3BP antibody

ITGB3BP (Integrin beta 3 Binding Protein, Beta-3-endonexin, Centromere Protein R, CENPR, CENP-R, HSU37139, Nuclear Receptor-interacting Factor 3, NRIF3, TAP20)

Gene Names
ITGB3BP; CENPR; NRIF3; TAP20; CENP-R; HSU37139
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ITGB3BP; Monoclonal Antibody; ITGB3BP (Integrin beta 3 Binding Protein; Beta-3-endonexin; Centromere Protein R; CENPR; CENP-R; HSU37139; Nuclear Receptor-interacting Factor 3; NRIF3; TAP20); Anti -ITGB3BP (Integrin beta 3 Binding Protein; anti-ITGB3BP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F6
Specificity
Recognizes human ITGB3BP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
Applicable Applications for anti-ITGB3BP antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-100, from ITGB3BP (AAH14385) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(ITGB3BP monoclonal antibody Western Blot analysis of ITGB3BP expression in A-431.)

Western Blot (WB) (ITGB3BP monoclonal antibody Western Blot analysis of ITGB3BP expression in A-431.)

Western Blot (WB)

(Western Blot analysis of ITGB3BP expression in transfected 293T cell line by ITGB3BP monoclonal antibody.|Lane 1: ITGB3BP transfected lysate (20.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ITGB3BP expression in transfected 293T cell line by ITGB3BP monoclonal antibody.|Lane 1: ITGB3BP transfected lysate (20.2kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ITGB3BP on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ITGB3BP on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ITGB3BP is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITGB3BP is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-ITGB3BP antibody
ITGB3BP is a transcriptional coregulator that has both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP also acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit. ITGB3BP induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization. It also acts as a component of the CENPH-CENPI centromeric complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation.
Product Categories/Family for anti-ITGB3BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
20,194 Da
NCBI Official Full Name
ITGB3BP protein
NCBI Official Synonym Full Names
integrin beta 3 binding protein (beta3-endonexin)
NCBI Official Symbol
ITGB3BP
NCBI Official Synonym Symbols
CENPR; NRIF3; TAP20; CENP-R; HSU37139
NCBI Protein Information
centromere protein R; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3
UniProt Protein Name
Centromere protein R
Protein Family
UniProt Gene Name
ITGB3BP
UniProt Synonym Gene Names
CENPR; NRIF3; CENP-R
UniProt Entry Name
CENPR_HUMAN

NCBI Description

This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

Function: Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Ref.2 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13

Subunit structure: Homodimer; mediated by the coiled coil domain. Isoform 3, but not other isoforms, interacts with the cytoplasmic tail of integrin ITGB3. The relevance of the interaction with ITGB3 is however uncertain, since isoform 3 is mainly nuclear. Interacts with CCNA2 and MTA1. Interacts with NFKB1 NF-kappa-B subunit. Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and MLF1IP/CENPU. Ref.1 Ref.2 Ref.8 Ref.9 Ref.10 Ref.12 Ref.13 Ref.14

Subcellular location: Isoform 1: Nucleus Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13. Chromosome › centromere. Chromosome › centromere › kinetochore Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13. Isoform 2: Nucleus Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13. Isoform 3: Nucleus Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13. Cytoplasm Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13. Note: Isoform 3 is predominantly nuclear and weakly cytoplasmic. Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13Isoform 4: Cytoplasm Ref.2 Ref.6 Ref.7 Ref.9 Ref.10 Ref.13.

Tissue specificity: Widely expressed. Expressed in spleen, thymus, prostate, ovary, small intestine and white blood cells. Highly expressed in testis and colon. Isoform 4 is expressed in platelets, lymphocytes and granulocytes. Ref.1 Ref.6

Induction: By estrogen. Ref.12

Domain: The DD1 domain (also called RepD1 domain) mediates the corepressor function and is essential in the triggering of apoptosis. Ref.11Contains one Leu-Xaa-Xaa-Leu-Leu (LXXLL) motif, a motif known to be important for the association with nuclear receptors. Such motif, which is required for an efficient association with nuclear receptors, is however not essential. Ref.11Contains one Leu-Xaa-Xaa-Ile-Leu (LXXIL) motif, which is essential for the association with nuclear receptors. Ref.11

Sequence caution: The sequence AAH14385.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on ITGB3BP

Similar Products

Product Notes

The ITGB3BP itgb3bp (Catalog #AAA646878) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGB3BP (Integrin beta 3 Binding Protein, Beta-3-endonexin, Centromere Protein R, CENPR, CENP-R, HSU37139, Nuclear Receptor-interacting Factor 3, NRIF3, TAP20) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB3BP can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ITGB3BP itgb3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLFASPTSS EEQKHRNGLS NEKRKKLNHP SLTESKESTT KDNDEFMMLL SKVEKLSEEI MEIMQNLSSI QALEGSRELE NLIGISCASH FLKREMQKTK. It is sometimes possible for the material contained within the vial of "ITGB3BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.