Western Blot (WB)
(WB Suggested Anti-C5orf39 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Rabbit anti-Human C5orf39 Polyclonal Antibody | anti-ANXA2R antibody
C5orf39 antibody - N-terminal region
Gene Names
ANXA2R; AX2R; AXIIR; C5orf39
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C5orf39; Polyclonal Antibody; C5orf39 antibody - N-terminal region; anti-ANXA2R antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Sequence Length
193
Applicable Applications for anti-ANXA2R antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf39
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C5orf39 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-C5orf39 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Related Product Information for anti-ANXA2R antibody
This is a rabbit polyclonal antibody against C5orf39. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Target Description: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Product Categories/Family for anti-ANXA2R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
annexin-2 receptor
NCBI Official Synonym Full Names
annexin A2 receptor
NCBI Official Symbol
ANXA2R
NCBI Official Synonym Symbols
AX2R; AXIIR; C5orf39
NCBI Protein Information
annexin-2 receptor
UniProt Protein Name
Annexin-2 receptor
Protein Family
UniProt Gene Name
ANXA2R
UniProt Synonym Gene Names
AX2R; C5orf39; AXIIR
UniProt Entry Name
AX2R_HUMAN
Uniprot Description
Function: May act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation. Ref.1
Tissue specificity: Widely expressed. Highly expressed in lymphocytes. Expressed in both resting CD4+ and CD8+ T-cells. Ref.1
Caution: Ref.1 reports that it is a type I membrane protein. However, no clear transmembrane region is detected by prediction methods, suggesting that its localization at the plasma membrane is unsure.
Research Articles on ANXA2R
Similar Products
Product Notes
The ANXA2R anxa2r (Catalog #AAA3211667) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C5orf39 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C5orf39 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANXA2R anxa2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQHFLGCVKR AWDSAEVAPE PQPPPIVSSE DRGPWPLPLY PVLGEYSLDS. It is sometimes possible for the material contained within the vial of "C5orf39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
