Western Blot (WB)
(C12ORF24 antibody (MBS5300165) used at 1 ug/ml to detect target protein.)
Rabbit C12ORF24 Polyclonal Antibody | anti-C12ORF24 antibody
C12ORF24 antibody
Gene Names
FAM216A; C12orf24; HSU79274
Applications
Western Blot
Purity
Affinity purified
Synonyms
C12ORF24; Polyclonal Antibody; C12ORF24 antibody; Polyclonal C12ORF24; Anti-C12ORF24; Chromosome ORF 12; Chromosome ORF-12; HSU79274; Chromosome 12 ORF; anti-C12ORF24 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C12ORF24 antibody was raised against the N terminal Of C12Orf24
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF24 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
273
Applicable Applications for anti-C12ORF24 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of C12orf24 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human
Immunogen
C12ORF24 antibody was raised using the N terminal Of C12Orf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C12ORF24 antibody (MBS5300165) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C12ORF24 antibody (MBS5300165) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C12ORF24 antibody
Rabbit polyclonal C12ORF24 antibody raised against the N terminal Of C12Orf24
Product Categories/Family for anti-C12ORF24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
31 kDa (MW of target protein)
NCBI Official Full Name
chromosome 12 open reading frame 24, isoform CRA_c
NCBI Official Synonym Full Names
family with sequence similarity 216, member A
NCBI Official Symbol
FAM216A
NCBI Official Synonym Symbols
C12orf24; HSU79274
NCBI Protein Information
protein FAM216A
UniProt Protein Name
Protein FAM216A
UniProt Gene Name
FAM216A
UniProt Synonym Gene Names
C12orf24
UniProt Entry Name
F216A_HUMAN
Uniprot Description
FAM216A: Belongs to the FAM216 family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 12q24.11
Similar Products
Product Notes
The C12ORF24 fam216a (Catalog #AAA5300165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C12ORF24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C12ORF24 fam216a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C12ORF24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
