Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHCHD3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

Rabbit CHCHD3 Polyclonal Antibody | anti-CHCHD3 antibody

CHCHD3 antibody - middle region

Gene Names
CHCHD3; Mic19; MINOS3; MICOS19; PPP1R22
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHCHD3; Polyclonal Antibody; CHCHD3 antibody - middle region; anti-CHCHD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY
Sequence Length
227
Applicable Applications for anti-CHCHD3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHCHD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHCHD3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-CHCHD3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Related Product Information for anti-CHCHD3 antibody
This is a rabbit polyclonal antibody against CHCHD3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-CHCHD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
MICOS complex subunit MIC19 isoform 2
NCBI Official Synonym Full Names
coiled-coil-helix-coiled-coil-helix domain containing 3
NCBI Official Symbol
CHCHD3
NCBI Official Synonym Symbols
Mic19; MINOS3; MICOS19; PPP1R22
NCBI Protein Information
MICOS complex subunit MIC19
UniProt Protein Name
MICOS complex subunit MIC19
UniProt Gene Name
CHCHD3
UniProt Synonym Gene Names
MIC19; MINOS3
UniProt Entry Name
MIC19_HUMAN

NCBI Description

The protein encoded by this gene is an inner mitochondrial membrane scaffold protein. Absence of the encoded protein affects the structural integrity of mitochondrial cristae and leads to reductions in ATP production, cell growth, and oxygen consumption. This protein is part of the mitochondrial contact site and cristae organizing system (MICOS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

CHCHD3: May be a scaffolding protein that stabilizes protein complexes involved in maintaining mitochondrial crista architecture and protein import.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: mitochondrion; cytoplasm; mitochondrial inner membrane; nucleus

Molecular Function: protein binding; protein complex scaffold; phosphatase binding

Biological Process: inner mitochondrial membrane organization and biogenesis; mitochondrial fusion; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on CHCHD3

Similar Products

Product Notes

The CHCHD3 chchd3 (Catalog #AAA3213144) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHCHD3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CHCHD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHCHD3 chchd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRERICSEEE RAKAKHLARQ LEEKDRVLKK QDAFYKEQLA RLEERSSEFY. It is sometimes possible for the material contained within the vial of "CHCHD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.