Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ERCC5Sample Type: Ovary tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ERCC5 Polyclonal Antibody | anti-ERCC5 antibody

ERCC5 Antibody - N-terminal region

Gene Names
ERCC5; XPG; UVDR; XPGC; COFS3; ERCM2; ERCC5-201
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERCC5; Polyclonal Antibody; ERCC5 Antibody - N-terminal region; anti-ERCC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES
Sequence Length
1180
Applicable Applications for anti-ERCC5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ERCC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ERCC5Sample Type: Ovary tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ERCC5Sample Type: Ovary tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ERCC5 antibody
This is a rabbit polyclonal antibody against ERCC5. It was validated on Western Blot

Target Description: This gene encodes a single-strand specific DNA endonuclease that makes the 3' incision in DNA excision repair following UV-induced damage. The protein may also function in other cellular processes, including RNA polymerase II transcription, and transcription-coupled DNA repair. Mutations in this gene cause xeroderma pigmentosum complementation group G (XP-G), which is also referred to as xeroderma pigmentosum VII (XP7), a skin disorder characterized by hypersensitivity to UV light and increased susceptibility for skin cancer development following UV exposure. Some patients also develop Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Read-through transcription exists between this gene and the neighboring upstream BIVM (basic, immunoglobulin-like variable motif containing) gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130kDa
NCBI Official Full Name
DNA repair protein complementing XP-G cells
NCBI Official Synonym Full Names
ERCC excision repair 5, endonuclease
NCBI Official Symbol
ERCC5
NCBI Official Synonym Symbols
XPG; UVDR; XPGC; COFS3; ERCM2; ERCC5-201
NCBI Protein Information
DNA repair protein complementing XP-G cells
UniProt Protein Name
DNA repair protein complementing XP-G cells
Protein Family
UniProt Gene Name
ERCC5
UniProt Synonym Gene Names
ERCM2; XPG; XPGC
UniProt Entry Name
ERCC5_HUMAN

NCBI Description

This gene encodes a single-strand specific DNA endonuclease that makes the 3' incision in DNA excision repair following UV-induced damage. The protein may also function in other cellular processes, including RNA polymerase II transcription, and transcription-coupled DNA repair. Mutations in this gene cause xeroderma pigmentosum complementation group G (XP-G), which is also referred to as xeroderma pigmentosum VII (XP7), a skin disorder characterized by hypersensitivity to UV light and increased susceptibility for skin cancer development following UV exposure. Some patients also develop Cockayne syndrome, which is characterized by severe growth defects, cognitive disability, and cachexia. Read-through transcription exists between this gene and the neighboring upstream BIVM (basic, immunoglobulin-like variable motif containing) gene. [provided by RefSeq, Feb 2011]

Uniprot Description

XPG: Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too. Defects in ERCC5 are the cause of xeroderma pigmentosum complementation group G (XP-G); also known as xeroderma pigmentosum VII (XP7). Xeroderma pigmentosum is an autosomal recessive pigmentary skin disorder characterized by solar hypersensitivity of the skin, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. Some XP-G patients present features of Cockayne syndrome, including dwarfism, sensorineural deafness, microcephaly, mental retardation, pigmentary retinopathy, ataxia, decreased nerve conduction velocities. Belongs to the XPG/RAD2 endonuclease family. XPG subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Deoxyribonuclease; DNA repair, damage; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 13q33

Cellular Component: nucleoplasm; intermediate filament cytoskeleton; DNA replication factor A complex; holo TFIIH complex; DNA-directed RNA polymerase II, holoenzyme; nucleus

Molecular Function: protein binding; protein homodimerization activity; metal ion binding; endonuclease activity; double-stranded DNA binding; protein N-terminus binding; bubble DNA binding; single-stranded DNA binding; endodeoxyribonuclease activity

Biological Process: nucleotide-excision repair, DNA incision, 3'-to lesion; UV protection; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; nucleotide-excision repair, DNA damage removal; DNA repair; DNA catabolic process, endonucleolytic; response to UV-C; negative regulation of apoptosis; response to UV

Disease: Xeroderma Pigmentosum, Complementation Group G

Research Articles on ERCC5

Similar Products

Product Notes

The ERCC5 ercc5 (Catalog #AAA3211578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERCC5 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ERCC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERCC5 ercc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HSGHIRRQYE DEGGFLKEVE SRRVVSEDTS HYILIKGIQA KTVAEVDSES. It is sometimes possible for the material contained within the vial of "ERCC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.