Western Blot (WB)
(WB Suggested Anti-ADPRH AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Rabbit ADPRH Polyclonal Antibody | anti-ADPRH antibody
ADPRH antibody - C-terminal region
Gene Names
ADPRH; ARH1; hARH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADPRH; Polyclonal Antibody; ADPRH antibody - C-terminal region; anti-ADPRH antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTV
Sequence Length
357
Applicable Applications for anti-ADPRH antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 93%; Zebrafish: 75%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ADPRH AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Western Blot (WB)
(WB Suggested Anti-ADPRH AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-ADPRH antibody
This is a rabbit polyclonal antibody against ADPRH. It was validated on Western Blot
Target Description: The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes, which require DTT for maximal activity, the human enzyme is DTT-independent.
Target Description: The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes, which require DTT for maximal activity, the human enzyme is DTT-independent.
Product Categories/Family for anti-ADPRH antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
ADP-ribosylarginine hydrolase isoform 1
NCBI Official Synonym Full Names
ADP-ribosylarginine hydrolase
NCBI Official Symbol
ADPRH
NCBI Official Synonym Symbols
ARH1; hARH1
NCBI Protein Information
ADP-ribosylarginine hydrolase
UniProt Protein Name
[Protein ADP-ribosylarginine] hydrolase
Protein Family
UniProt Gene Name
ADPRH
UniProt Synonym Gene Names
ARH1; ADP-ribosylarginine hydrolase
UniProt Entry Name
ADPRH_HUMAN
NCBI Description
The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, May 2014]
Uniprot Description
ADPRH: Catalyzes the reverse reaction of mono-ADP-ribosylation. Belongs to the ADP-ribosylglycohydrolase family.
Protein type: EC 3.2.2.19; Hydrolase
Chromosomal Location of Human Ortholog: 3q13.31-q13.33
Molecular Function: ADP-ribosylarginine hydrolase activity; magnesium ion binding
Biological Process: protein amino acid de-ADP-ribosylation; protein modification process
Research Articles on ADPRH
Similar Products
Product Notes
The ADPRH adprh (Catalog #AAA3210507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADPRH antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ADPRH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADPRH adprh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STAAIAGCWW GVMYGFKGVS PSNYEKLEYR NRLEETARAL YSLGSKEDTV. It is sometimes possible for the material contained within the vial of "ADPRH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
