Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PBEF1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Rabbit PBEF1 Polyclonal Antibody | anti-NAMPT antibody

PBEF1 antibody - C-terminal region

Gene Names
NAMPT; VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PBEF1; Polyclonal Antibody; PBEF1 antibody - C-terminal region; anti-NAMPT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL
Sequence Length
491
Applicable Applications for anti-NAMPT antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PBEF1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PBEF1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-NAMPT antibody
This is a rabbit polyclonal antibody against PBEF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
Nicotinamide phosphoribosyltransferase
NCBI Official Synonym Full Names
nicotinamide phosphoribosyltransferase
NCBI Official Symbol
NAMPT
NCBI Official Synonym Symbols
VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik
NCBI Protein Information
nicotinamide phosphoribosyltransferase
UniProt Protein Name
Nicotinamide phosphoribosyltransferase
UniProt Gene Name
NAMPT
UniProt Synonym Gene Names
PBEF; PBEF1; NAmPRTase; Nampt; Pre-B cell-enhancing factor
UniProt Entry Name
NAMPT_HUMAN

NCBI Description

This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10. [provided by RefSeq, Feb 2011]

Uniprot Description

PBEF: an ubiquitous protein originally described as a cytokine which acts on early B-lineage precursor cells. Other reports indicate that PBEF is not a cytokine-like secreted protein but an intracellular protein associated with the cell cycle. Contains a catalytically active nicotinate phosphoribosyltransferase domain, an enzyme involved in nicotinamide adenine dinucleotide (NAD) biosynthesis.

Protein type: Cell cycle regulation; Transferase; EC 2.4.2.12; Cytokine; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide

Chromosomal Location of Human Ortholog: 7q22.3

Cellular Component: extracellular space; cytosol; nucleus

Molecular Function: protein binding; protein homodimerization activity; cytokine activity; nicotinate-nucleotide diphosphorylase (carboxylating) activity; drug binding; nicotinamide phosphoribosyltransferase activity

Biological Process: circadian rhythm; vitamin metabolic process; positive regulation of smooth muscle cell proliferation; female pregnancy; signal transduction; response to organic cyclic substance; NAD biosynthetic process; cell-cell signaling; NAD metabolic process; nicotinamide metabolic process; positive regulation of cell proliferation; insulin receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; water-soluble vitamin metabolic process; positive regulation of nitric-oxide synthase biosynthetic process

Research Articles on NAMPT

Similar Products

Product Notes

The NAMPT nampt (Catalog #AAA3206272) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PBEF1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PBEF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAMPT nampt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSYVVTNGLG INVFKDPVAD PNKRSKKGRL SLHRTPAGNF VTLEEGKGDL. It is sometimes possible for the material contained within the vial of "PBEF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.