Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZCRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Rabbit ZCRB1 Polyclonal Antibody | anti-ZCRB1 antibody

ZCRB1 antibody - N-terminal region

Gene Names
ZCRB1; MADP1; RBM36; MADP-1; SNRNP31; ZCCHC19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZCRB1; Polyclonal Antibody; ZCRB1 antibody - N-terminal region; anti-ZCRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS
Sequence Length
217
Applicable Applications for anti-ZCRB1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZCRB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZCRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-ZCRB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Related Product Information for anti-ZCRB1 antibody
This is a rabbit polyclonal antibody against ZCRB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge conn
Product Categories/Family for anti-ZCRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
zinc finger CCHC-type and RNA-binding motif-containing protein 1
NCBI Official Synonym Full Names
zinc finger CCHC-type and RNA binding motif containing 1
NCBI Official Symbol
ZCRB1
NCBI Official Synonym Symbols
MADP1; RBM36; MADP-1; SNRNP31; ZCCHC19
NCBI Protein Information
zinc finger CCHC-type and RNA-binding motif-containing protein 1
UniProt Protein Name
Zinc finger CCHC-type and RNA-binding motif-containing protein 1
UniProt Gene Name
ZCRB1
UniProt Synonym Gene Names
U11/U12 snRNP 31 kDa protein; U11/U12-31K
UniProt Entry Name
ZCRB1_HUMAN

NCBI Description

Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge connecting both ends of the intron. The protein encoded by this gene contains a RNA recognition motif. It was identified as one of the protein components of U11/U12 snRNPs. This protein and many other U11/U12 snRNP proteins are highly conserved in organisms known to contain U12-type introns. These proteins have been shown to be essential for cell viability, suggesting the key roles in U12-type splicing. [provided by RefSeq, Jul 2008]

Uniprot Description

ZCRB1: Up-regulated by morphine. Down-regulated at 30-36 degrees Celsius while it is up-regulated at 39 degrees Celsius. Component of the U11/U12 snRNPs that are part of the U12- type spliceosome.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: nucleoplasm; U12-dependent spliceosome

Molecular Function: zinc ion binding; nucleotide binding

Biological Process: RNA splicing; mRNA processing

Research Articles on ZCRB1

Similar Products

Product Notes

The ZCRB1 zcrb1 (Catalog #AAA3205627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZCRB1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ZCRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZCRB1 zcrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSGGLAPSKS TVYVSNLPFS LTNNDLYRIF SKYGKVVKVT IMKDKDTRKS. It is sometimes possible for the material contained within the vial of "ZCRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.