Rabbit NXF5 Polyclonal Antibody | anti-NXF5 antibody

NXF5 antibody - middle region

Cat. Num. AAA3205623

• Reactivity: Dog, Human, Mouse, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: NXF5; Polyclonal Antibody; NXF5 antibody - middle region; anti-NXF5 antibody

• Host: Rabbit
• Reactivity: Dog, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
• Sequence Length: 397

• Applicable Applications for anti-NXF5 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Dog: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NXF5
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-NXF5 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-NXF5 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Lanes:Lane 1: 7ug HeLa cystosolic extractLane 2: 7ug HeLa nuclear extractPrimary Antibody Dilution:1:100Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NXF5Submitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)

Western Blot (WB)

(WB Suggested Anti-NXF5 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Related Product Information for anti-NXF5 antibody

This is a rabbit polyclonal antibody against NXF5. It was validated on Western Blot and immunohistochemistry

Target Description: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.

Product Categories/Family for anti-NXF5 antibody

Polyclonal; RNA Binding Proteins; Chromatin & Nuclear Signaling; E3 & Ubiquitin; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 254039592
• NCBI GeneID: 55998
• NCBI Accession #: NP_116564
• NCBI GenBank Nucleotide #: NM_032946
• UniProt Accession #: Q9H1B4
• Molecular Weight: 44kDa
• NCBI Official Full Name: nuclear RNA export factor 5
• NCBI Official Synonym Full Names: nuclear RNA export factor 5
• NCBI Official Symbol: NXF5
• NCBI Protein Information: nuclear RNA export factor 5
• UniProt Protein Name: Nuclear RNA export factor 5
• Protein Family: Nuclear RNA export factor
• UniProt Gene Name: NXF5
• UniProt Synonym Gene Names: TAPL1; TAPL-1
• UniProt Entry Name: NXF5_HUMAN

NCBI Description

This gene is one member of a family of nuclear RNA export factor genes. The encoded protein can bind RNA, and is implicated in mRNA nuclear export. However, this protein has lost several C-terminal protein domains found in other family members that are required for export activity, and may be an evolving pseudogene. Alternatively spliced transcript variants have been described, but most are candidates for nonsense-mediated decay (NMD) and may not express proteins in vivo. [provided by RefSeq, Jul 2009]

Uniprot Description

NXF5: Could be involved in the export of mRNA from the nucleus to the cytoplasm. Could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons. A chromosomal aberration involving NXF5 has been observed in one patient with a syndromic form of mental retardation and short stature. Pericentric inversion inv(X)(p21.1;q22) that interrupts NXF5. Belongs to the NXF family. 6 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; RNA binding; nucleotide binding

Biological Process: mRNA export from nucleus; multicellular organismal development; RNA transport