Immunohistochemistry (IHC)
(Rabbit Anti-KLHDC8A antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: bronchiole epitheliumAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit KLHDC8A Polyclonal Antibody | anti-KLHDC8A antibody
KLHDC8A antibody - C-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
KLHDC8A; Polyclonal Antibody; KLHDC8A antibody - C-terminal region; anti-KLHDC8A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
Sequence Length
350
Applicable Applications for anti-KLHDC8A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KLHDC8A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-KLHDC8A antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: bronchiole epitheliumAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-KLHDC8A antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: bronchiole epitheliumAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-KLHDC8A Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-KLHDC8A Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-KLHDC8A antibody
This is a rabbit polyclonal antibody against KLHDC8A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function remains unknown.
Target Description: The function remains unknown.
Product Categories/Family for anti-KLHDC8A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
kelch domain-containing protein 8A
NCBI Official Synonym Full Names
kelch domain containing 8A
NCBI Official Symbol
KLHDC8A
NCBI Protein Information
kelch domain-containing protein 8A
UniProt Protein Name
Kelch domain-containing protein 8A
Protein Family
UniProt Gene Name
KLHDC8A
UniProt Synonym Gene Names
S-delta-E1
UniProt Entry Name
KLD8A_HUMAN
NCBI Description
This gene encodes a kelch domain-containing protein which is upregulated in cancer. Upregulated expression of the encoded protein may provide an alternative pathway for tumors to maintain aggressiveness in the absence of epidermal growth factor receptor dependence. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]
Research Articles on KLHDC8A
Similar Products
Product Notes
The KLHDC8A klhdc8a (Catalog #AAA3205535) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHDC8A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLHDC8A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KLHDC8A klhdc8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGKNKWEILP AMPTPRCACS SIVVKNCLLA VGGVNQGLSD AVEALCVSDS. It is sometimes possible for the material contained within the vial of "KLHDC8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
