Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateAIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit SCYE1 Polyclonal Antibody | anti-AIMP1 antibody

SCYE1 antibody - N-terminal region

Gene Names
AIMP1; p43; HLD3; EMAP2; SCYE1; EMAPII
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCYE1; Polyclonal Antibody; SCYE1 antibody - N-terminal region; anti-AIMP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF
Sequence Length
312
Applicable Applications for anti-AIMP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SCYE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateAIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateAIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-AIMP1 antibody
This is a rabbit polyclonal antibody against SCYE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.The protein encoded by this gene is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
aminoacyl tRNA synthase complex-interacting multifunctional protein 1 isoform a
NCBI Official Synonym Full Names
aminoacyl tRNA synthetase complex interacting multifunctional protein 1
NCBI Official Symbol
AIMP1
NCBI Official Synonym Symbols
p43; HLD3; EMAP2; SCYE1; EMAPII
NCBI Protein Information
aminoacyl tRNA synthase complex-interacting multifunctional protein 1
UniProt Protein Name
Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
UniProt Gene Name
AIMP1
UniProt Synonym Gene Names
EMAP2; SCYE1; EMAP-2; EMAP-II
UniProt Entry Name
AIMP1_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that is specifically induced by apoptosis, and it is involved in the control of angiogenesis, inflammation, and wound healing. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor protein is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex, and it modulates aminoacylation activity of tRNA synthetase in normal cells. This protein is also involved in the stimulation of inflammatory responses after proteolytic cleavage in tumor cells. Multiple transcript variants encoding different isoforms have been found for this gene. A pseudogene has been identified on chromosome 20. [provided by RefSeq, Dec 2008]

Uniprot Description

SCYE1 iso2: Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1- mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7. Defects in AIMP1 are the cause of leukodystrophy hypomyelinating type 3 (HLD3). A severe autosomal recessive hypomyelinating leukodystrophy characterized by early infantile onset of global developmental delay, lack of development, lack of speech acquisition, and peripheral spasticity associated with decreased myelination in the central nervous system. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: Golgi apparatus; extracellular space; aminoacyl-tRNA synthetase multienzyme complex; transport vesicle; cell surface; membrane; endoplasmic reticulum; cytoplasm; nucleus; cytosol

Molecular Function: methionine-tRNA ligase activity; protein binding; protein homodimerization activity; cytokine activity; tRNA binding

Biological Process: tRNA aminoacylation for protein translation; cell-cell signaling; apoptosis; negative regulation of endothelial cell proliferation; response to wounding; methionyl-tRNA aminoacylation; glucose metabolic process; gene expression; angiogenesis; signal transduction; inflammatory response; chemotaxis; cell adhesion; leukocyte migration

Disease: Leukodystrophy, Hypomyelinating, 3

Research Articles on AIMP1

Similar Products

Product Notes

The AIMP1 aimp1 (Catalog #AAA3205314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCYE1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SCYE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AIMP1 aimp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLKEKAILQA TLREEKKLRV ENAKLKKEIE ELKQELIQAE IQNGVKQIPF. It is sometimes possible for the material contained within the vial of "SCYE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.