Western Blot (WB)
(WB Suggested Anti-RBM4 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateRBM4 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Rabbit anti-Human RBM4 Polyclonal Antibody | anti-RBM4 antibody
RBM4 antibody - C-terminal region
Gene Names
RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBM4; Polyclonal Antibody; RBM4 antibody - C-terminal region; anti-RBM4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ
Sequence Length
364
Applicable Applications for anti-RBM4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RBM4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RBM4 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateRBM4 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Western Blot (WB)
(WB Suggested Anti-RBM4 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateRBM4 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-RBM4 antibody
This is a rabbit polyclonal antibody against RBM4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.
Target Description: RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.
Product Categories/Family for anti-RBM4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40kDa
NCBI Official Full Name
RNA-binding protein 4 isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein 4
NCBI Official Symbol
RBM4
NCBI Official Synonym Symbols
LARK; RBM4A; ZCRB3A; ZCCHC21
NCBI Protein Information
RNA-binding protein 4
UniProt Protein Name
RNA-binding protein 40
Protein Family
UniProt Gene Name
RNPC3
UniProt Synonym Gene Names
KIAA1839; RBM40; RNP; U11/U12 snRNP 65 kDa protein; U11/U12-65K
UniProt Entry Name
RBM40_HUMAN
Research Articles on RBM4
Similar Products
Product Notes
The RBM4 rnpc3 (Catalog #AAA3205216) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM4 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBM4 rnpc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQQQPLLLLL QLPLHITGGI GAPCVALQPQ SPLLERATVT GMRVSCPKLQ. It is sometimes possible for the material contained within the vial of "RBM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
